SSTR4 (somatostatin receptor 4)

Gene

• Entrez ID: 6754
• Gene name: Somatostatin receptor 4
• Gene symbol: SSTR4
• Synonyms: SS-4-R, SS4-R, SS4R, SST4
• Chromosome: 20
• Chromosome location: 20p11.21
• Summary: Somatostatin acts at many sites to inhibit the release of many hormones and other secretory proteins. The biologic effects of somatostatin are probably mediated by a family of G protein-coupled receptors that are expressed in a tissue-specific manner. S

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IBA	21873635
GO:0004994	Function	Somatostatin receptor activity	IBA	21873635
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	8405411
GO:0007218	Process	Neuropeptide signaling pathway	IBA	21873635
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	9892014
GO:0016477	Process	Cell migration	IEA
GO:0030900	Process	Forebrain development	IEA
GO:0038170	Process	Somatostatin signaling pathway	IEA
GO:0042277	Function	Peptide binding	IBA	21873635
GO:0042923	Function	Neuropeptide binding	IBA	21873635
GO:0043005	Component	Neuron projection	IBA	21873635
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0071385	Process	Cellular response to glucocorticoid stimulus	IBA	21873635
GO:0090238	Process	Positive regulation of arachidonic acid secretion	IEA
GO:0106072	Process	Negative regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA

Other IDs

• MIM: 182454
• HGNC: 11333
• e!Ensembl: ENSG00000132671

Protein

• UniProt ID: P31391
• Protein name: Somatostatin receptor type 4 (SS-4-R) (SS4-R) (SS4R) (SST4)
• Protein function: Receptor for somatostatin-14. The activity of this receptor is mediated by G proteins which inhibits adenylyl cyclase. It is functionally coupled not only to inhibition of adenylate cyclase, but also to activation of both arachidonate release an
• PDB: 7XMS, 7XMT
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	64 → 311	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MSAPSTLPPGGEEGLGTAWPSAANASSAPAEAEEAVAGPGDARAAGMVAIQCIYALVCLV
  GLVGNALVIFVILRYAKMKTATNIYLLNLAVADELFMLSVPFVASSAALRHWPFGSVLCR
  AVLSVDGLNMFTSVFCLTVLSVDRYVAVVHPLRAATYRRPSVAKLINLGVWLASLLVTLP
  IAIFADTRPARGGQAVACNLQWPHPAWSAVFVVYTFLLGFLLPVLAIGLCYLLIVGKMRA
  VALRAGWQQRRRSEKKITRLVLMVVVVFVLCWMPFYVVQLLNLFVTSLDATVNHVSLILS
  YANSCANPILYGFLSDNFRRFFQRVLCLRCCLLEGAGGAEEEPLDYYATALKSKGGAGCM
  CPPLPCQQEALQPEPGRKRIPLTRTTTF

• Sequence length: 388

Pathways

KEGG:

Neuroactive ligand-receptor interaction
Hormone signaling

Reactome:

Peptide ligand-binding receptors
G alpha (i) signalling events

Associated diseases

Unknown
Disease name	Disease term	dbSNP ID	References
Grand mal status epilepticus	Grand Mal Status Epilepticus		18951627
Nonconvulsive status epilepticus	Non-Convulsive Status Epilepticus		18951627
Petit mal status	Petit mal status		18951627
Status epilepticus	Status Epilepticus, Complex Partial Status Epilepticus, Status Epilepticus, Subclinical		18951627