SSTR1 (somatostatin receptor 1)

Gene

• Entrez ID: 6751
• Gene name: Somatostatin receptor 1
• Gene symbol: SSTR1
• Synonyms: SRIF-2, SS-1-R, SS1-R, SS1R, SST1
• Chromosome: 14
• Chromosome location: 14q21.1
• Summary: Somatostatins are peptide hormones that regulate diverse cellular functions such as neurotransmission, cell proliferation, and endocrine signaling as well as inhibiting the release of many hormones and other secretory proteins. Somatostatin has two active

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT484403	hsa-miR-4716-3p	PAR-CLIP	20371350
MIRT484402	hsa-miR-6794-5p	PAR-CLIP	20371350
MIRT484400	hsa-miR-4285	PAR-CLIP	20371350
MIRT484401	hsa-miR-4767	PAR-CLIP	20371350
MIRT484399	hsa-miR-4467	PAR-CLIP	20371350
MIRT484398	hsa-miR-8089	PAR-CLIP	20371350
MIRT490694	hsa-miR-5584-5p	PAR-CLIP	23592263
MIRT490693	hsa-miR-4436b-3p	PAR-CLIP	23592263
MIRT490692	hsa-miR-4632-5p	PAR-CLIP	23592263
MIRT490691	hsa-miR-6735-5p	PAR-CLIP	23592263
MIRT490690	hsa-miR-6879-5p	PAR-CLIP	23592263
MIRT490689	hsa-miR-7843-5p	PAR-CLIP	23592263
MIRT484403	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT484402	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT490688	hsa-miR-501-3p	PAR-CLIP	23592263
MIRT490687	hsa-miR-502-3p	PAR-CLIP	23592263
MIRT484400	hsa-miR-4285	PAR-CLIP	23592263
MIRT490686	hsa-miR-3616-3p	PAR-CLIP	23592263
MIRT484401	hsa-miR-4767	PAR-CLIP	23592263
MIRT490685	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT490684	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT484399	hsa-miR-4467	PAR-CLIP	23592263
MIRT490683	hsa-miR-3153	PAR-CLIP	23592263
MIRT490682	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT490681	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT490680	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT490679	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT490678	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT490677	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT490676	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT490675	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT484398	hsa-miR-8089	PAR-CLIP	23592263
MIRT484403	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT484402	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT484400	hsa-miR-4285	PAR-CLIP	23592263
MIRT484401	hsa-miR-4767	PAR-CLIP	23592263
MIRT484399	hsa-miR-4467	PAR-CLIP	23592263
MIRT484398	hsa-miR-8089	PAR-CLIP	23592263
MIRT484403	hsa-miR-4716-3p	PAR-CLIP	20371350
MIRT484402	hsa-miR-6794-5p	PAR-CLIP	20371350
MIRT484400	hsa-miR-4285	PAR-CLIP	20371350
MIRT484401	hsa-miR-4767	PAR-CLIP	20371350
MIRT484399	hsa-miR-4467	PAR-CLIP	20371350
MIRT484398	hsa-miR-8089	PAR-CLIP	20371350
MIRT490694	hsa-miR-5584-5p	PAR-CLIP	23592263
MIRT490693	hsa-miR-4436b-3p	PAR-CLIP	23592263
MIRT490692	hsa-miR-4632-5p	PAR-CLIP	23592263
MIRT490691	hsa-miR-6735-5p	PAR-CLIP	23592263
MIRT490690	hsa-miR-6879-5p	PAR-CLIP	23592263
MIRT490689	hsa-miR-7843-5p	PAR-CLIP	23592263
MIRT484403	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT484402	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT490688	hsa-miR-501-3p	PAR-CLIP	23592263
MIRT490687	hsa-miR-502-3p	PAR-CLIP	23592263
MIRT484400	hsa-miR-4285	PAR-CLIP	23592263
MIRT490686	hsa-miR-3616-3p	PAR-CLIP	23592263
MIRT484401	hsa-miR-4767	PAR-CLIP	23592263
MIRT490685	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT490684	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT484399	hsa-miR-4467	PAR-CLIP	23592263
MIRT490683	hsa-miR-3153	PAR-CLIP	23592263
MIRT490682	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT490681	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT490680	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT490679	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT490678	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT490677	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT490676	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT490675	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT484398	hsa-miR-8089	PAR-CLIP	23592263
MIRT484403	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT484402	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT484400	hsa-miR-4285	PAR-CLIP	23592263
MIRT484401	hsa-miR-4767	PAR-CLIP	23592263
MIRT484399	hsa-miR-4467	PAR-CLIP	23592263
MIRT484398	hsa-miR-8089	PAR-CLIP	23592263
MIRT1392815	hsa-miR-1228	CLIP-seq
MIRT1392816	hsa-miR-342-3p	CLIP-seq
MIRT1392817	hsa-miR-3920	CLIP-seq
MIRT1392818	hsa-miR-3940-5p	CLIP-seq
MIRT1392819	hsa-miR-3942-5p	CLIP-seq
MIRT1392820	hsa-miR-4326	CLIP-seq
MIRT1392821	hsa-miR-4422	CLIP-seq
MIRT1392822	hsa-miR-4507	CLIP-seq
MIRT1392823	hsa-miR-4691-5p	CLIP-seq
MIRT1392824	hsa-miR-4700-3p	CLIP-seq
MIRT1392825	hsa-miR-4703-5p	CLIP-seq
MIRT1392826	hsa-miR-4762-3p	CLIP-seq
MIRT1392827	hsa-miR-578	CLIP-seq
MIRT1392828	hsa-miR-635	CLIP-seq
MIRT2117888	hsa-miR-1908	CLIP-seq
MIRT2117889	hsa-miR-1915	CLIP-seq
MIRT2117890	hsa-miR-3613-3p	CLIP-seq
MIRT2117891	hsa-miR-361-3p	CLIP-seq
MIRT2117892	hsa-miR-4707-3p	CLIP-seq
MIRT2117893	hsa-miR-4766-5p	CLIP-seq
MIRT2117894	hsa-miR-663	CLIP-seq
MIRT2339839	hsa-miR-1185	CLIP-seq
MIRT2339840	hsa-miR-1262	CLIP-seq
MIRT2339841	hsa-miR-1292	CLIP-seq
MIRT2339842	hsa-miR-1293	CLIP-seq
MIRT2339843	hsa-miR-2115	CLIP-seq
MIRT2339844	hsa-miR-3155	CLIP-seq
MIRT2339845	hsa-miR-3155b	CLIP-seq
MIRT2339846	hsa-miR-3158-3p	CLIP-seq
MIRT2339847	hsa-miR-3679-5p	CLIP-seq
MIRT2339848	hsa-miR-4259	CLIP-seq
MIRT2339849	hsa-miR-4471	CLIP-seq
MIRT2339850	hsa-miR-4483	CLIP-seq
MIRT2339851	hsa-miR-4701-3p	CLIP-seq
MIRT2339852	hsa-miR-4703-3p	CLIP-seq
MIRT2339853	hsa-miR-4715-5p	CLIP-seq
MIRT2339854	hsa-miR-4721	CLIP-seq
MIRT2339855	hsa-miR-484	CLIP-seq
MIRT2339856	hsa-miR-508-5p	CLIP-seq
MIRT2339857	hsa-miR-767-3p	CLIP-seq
MIRT2433573	hsa-miR-149	CLIP-seq
MIRT2433574	hsa-miR-2054	CLIP-seq
MIRT2433575	hsa-miR-3064-5p	CLIP-seq
MIRT2433576	hsa-miR-3065-5p	CLIP-seq
MIRT2433577	hsa-miR-3613-5p	CLIP-seq
MIRT2433578	hsa-miR-374c	CLIP-seq
MIRT2433579	hsa-miR-3925-3p	CLIP-seq
MIRT2433580	hsa-miR-4445	CLIP-seq
MIRT2433581	hsa-miR-4794	CLIP-seq
MIRT2433582	hsa-miR-495	CLIP-seq
MIRT2433583	hsa-miR-655	CLIP-seq
MIRT2433584	hsa-miR-766	CLIP-seq
MIRT2460573	hsa-miR-3919	CLIP-seq
MIRT2460574	hsa-miR-642b	CLIP-seq
MIRT2460573	hsa-miR-3919	CLIP-seq
MIRT2633772	hsa-miR-4489	CLIP-seq
MIRT2460573	hsa-miR-3919	CLIP-seq
MIRT2633772	hsa-miR-4489	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
EZH2	Repression	22144423

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IBA	21873635
GO:0004994	Function	Somatostatin receptor activity	IBA	21873635
GO:0004994	Function	Somatostatin receptor activity	IDA	1346068
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	8405411
GO:0007215	Process	Glutamate receptor signaling pathway	IEA
GO:0007218	Process	Neuropeptide signaling pathway	IBA	21873635
GO:0007283	Process	Spermatogenesis	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	9886848
GO:0021549	Process	Cerebellum development	IEA
GO:0030900	Process	Forebrain development	IEA
GO:0038170	Process	Somatostatin signaling pathway	IEA
GO:0042277	Function	Peptide binding	IBA	21873635
GO:0042594	Process	Response to starvation	IEA
GO:0042923	Function	Neuropeptide binding	IBA	21873635
GO:0043005	Component	Neuron projection	IBA	21873635
GO:0071392	Process	Cellular response to estradiol stimulus	IBA	21873635
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA

Other IDs

• MIM: 182451
• HGNC: 11330
• e!Ensembl: ENSG00000139874

Protein

• UniProt ID: P30872
• Protein name: Somatostatin receptor type 1 (SS-1-R) (SS1-R) (SS1R) (SST1) (SRIF-2)
• Protein function: Receptor for somatostatin with higher affinity for somatostatin-14 than -28. This receptor is coupled via pertussis toxin sensitive G proteins to inhibition of adenylyl cyclase. In addition it stimulates phosphotyrosine phosphatase and Na(+)/H(+
• PDB: 8XIO, 8XIP
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	75 → 323	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MFPNGTASSPSSSPSPSPGSCGEGGGSRGPGAGAADGMEEPGRNASQNGTLSEGQGSAIL
  ISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLL
  RHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLG
  VWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQRWLVGFVLYTFLMGFLLPVGAIC
  LCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQD
  DATVSQLSVILGYANSCANPILYGFLSDNFKRSFQRILCLSWMDNAAEEPVDYYATALKS
  RAYSVEDFQPENLESGGVFRNGTCTSRITTL

• Sequence length: 391

Pathways

KEGG:

cAMP signaling pathway
Neuroactive ligand-receptor interaction
Hormone signaling
Growth hormone synthesis, secretion and action

Reactome:

Peptide ligand-binding receptors
G alpha (i) signalling events

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Pancreatic cancer	Malignant neoplasm of pancreas	rs118203998, rs180177143, rs587776417, rs587776527, rs864622498, rs876659571, rs587778587, rs886039619, rs745533713, rs1555460431, rs200612497	17625444

Unknown
Disease name	Disease term	dbSNP ID	References
Grand mal status epilepticus	Grand Mal Status Epilepticus		18951627
Neuroendocrine tumors	Neuroendocrine Tumors		17625444
Nonconvulsive status epilepticus	Non-Convulsive Status Epilepticus		18951627
Pancreatic neoplasm	Pancreatic Neoplasm		17625444
Petit mal status	Petit mal status		18951627
Status epilepticus	Status Epilepticus, Complex Partial Status Epilepticus, Status Epilepticus, Subclinical		18951627