GediPNet logo

BPGM (bisphosphoglycerate mutase)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
669
Gene nameGene Name - the full gene name approved by the HGNC.
Bisphosphoglycerate mutase
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
BPGM
SynonymsGene synonyms aliases
DPGM, ECYT8
ChromosomeChromosome number
7
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q33
SummarySummary of gene provided in NCBI Entrez Gene.
2,3-diphosphoglycerate (2,3-DPG) is a small molecule found at high concentrations in red blood cells where it binds to and decreases the oxygen affinity of hemoglobin. This gene encodes a multifunctional enzyme that catalyzes 2,3-DPG synthesis via its syn
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs121964925 C>T Pathogenic Missense variant, coding sequence variant
rs786205092 C>- Pathogenic Coding sequence variant, frameshift variant
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019319 hsa-miR-148b-3p Microarray 17612493
MIRT022045 hsa-miR-128-3p Microarray 17612493
MIRT023275 hsa-miR-122-5p Microarray 17612493
MIRT025166 hsa-miR-181a-5p Microarray 17612493
MIRT043853 hsa-miR-340-3p CLASH 23622248
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004082 Function Bisphosphoglycerate mutase activity IEA
GO:0004619 Function Phosphoglycerate mutase activity IEA
GO:0005515 Function Protein binding IPI 28514442, 32296183
GO:0005829 Component Cytosol TAS
GO:0005975 Process Carbohydrate metabolic process NAS 2542247
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID P07738
Protein name Bisphosphoglycerate mutase (BPGM) (EC 5.4.2.4) (2,3-bisphosphoglycerate mutase, erythrocyte) (2,3-bisphosphoglycerate synthase) (EC 5.4.2.11) (2,3-diphosphoglycerate mutase) (DPGM) (BPG-dependent PGAM)
Protein function Plays a major role in regulating hemoglobin oxygen affinity by controlling the levels of its allosteric effector 2,3-bisphosphoglycerate (2,3-BPG). Also exhibits mutase (EC 5.4.2.11) activity.
PDB 1T8P , 2A9J , 2F90 , 2H4X , 2H4Z , 2H52 , 2HHJ , 3NFY , 7N3R , 7N3S , 7THI , 8X2S
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00300 His_Phos_1
6 137
Histidine phosphatase superfamily (branch 1)
Domain
PF00300 His_Phos_1
127 229
Histidine phosphatase superfamily (branch 1)
Domain
Sequence
MSKYKLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFEFDLVFTSVL
NRSIHTAWLILEELGQEWVPVESSWRLNERHYGALIGLNREQMALNHGEEQVRLWRRSYN
VTPPPI
EESHPYYQEIYNDRRYKVCDVPLDQLPRSESLKDVLERLLPYWNERIAPEVLRG
KTILISAHGNSSRALLKHLEGISDEDIINITLPTGVPILLELDENLRAV
GPHQFLGDQEA
IQAAIKKVEDQGKVKQAKK
Sequence length 259
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
  Glycolysis
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Anemia Normocytic anemia rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966, rs137853122, rs137853123, rs786205060, rs267607121, rs121908584, rs80338697, rs80338699, rs120074166, rs120074167, rs1050828, rs74575103, rs137852314, rs5030868, rs137852316, rs137852317, rs137852318, rs137852319, rs137852320, rs137852321, rs137852322, rs137852323, rs137852324, rs72554665, rs387906468, rs5030872, rs137852326, rs137852333, rs137852327, rs137852328, rs137852329, rs137852330, rs137852331, rs137852332, rs137852334, rs137852335, rs137852336, rs137852339, rs76645461, rs137852340, rs137852341, rs78478128, rs137852343, rs137852344, rs137852345, rs587776730, rs137852346, rs137852347, rs137852349, rs2070404412, rs2070350038, rs2070350009, rs137852303, rs137852304, rs33946267, rs34378160, rs33933298, rs11549407, rs35724775, rs34598529, rs41469945, rs267607201, rs80338694, rs80338696, rs387907018, rs398123546, rs78365220, rs587777100, rs587777101, rs483352840, rs869312752, rs765487627, rs1557229599, rs1557230040, rs1555524842, rs782090947, rs1358275550, rs1557229736, rs1557230573, rs1556323334, rs1233124208, rs1293528130, rs146864395, rs1595503440, rs1603411214, rs137852325, rs1575247302, rs1603411177, rs1336651679, rs782322505
Cholelithiasis Cholelithiasis rs121918440, rs72552778, rs387906528, rs759202962, rs377160065, rs1051861187, rs757693457, rs752563752
Deficiency of bisphosphoglycerate mutase Deficiency of bisphosphoglycerate mutase rs121964925, rs786205092 2542247, 1421379, 15054810
Hemolytic anemia Nonspherocytic hemolytic anemia, Hemolytic anemia due to diphosphoglycerate mutase deficiency rs104894025, rs104894026, rs397518435, rs397518436, rs104894027, rs397518437, rs104894028, rs397518438, rs104894029, rs137853583, rs137853585, rs137853586, rs137853587, rs267606851, rs267606852, rs267606853, rs137853249, rs33924146, rs104894101, rs104894102, rs137853203, rs137853204, rs137853205, rs387906582, rs387906583, rs398122379, rs1064794848, rs774419705, rs1555367318, rs1345036090, rs1586033745, rs1571436535, rs2022057
Unknown
Disease name Disease term dbSNP ID References
Cholecystitis Cholecystitis
Polycythemia Polycythemia

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412