GediPNet logo

SNTA1 (syntrophin alpha 1)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6640
Gene nameGene Name - the full gene name approved by the HGNC.
Syntrophin alpha 1
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
SNTA1
SynonymsGene synonyms aliases
LQT12, SNT1, TACIP1, dJ1187J4.5
ChromosomeChromosome number
20
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20q11.21
SummarySummary of gene provided in NCBI Entrez Gene.
Syntrophins are cytoplasmic peripheral membrane scaffold proteins that are components of the dystrophin-associated protein complex. This gene is a member of the syntrophin gene family and encodes the most common syntrophin isoform found in cardiac tissues
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs56157422 G>A,C,T Conflicting-interpretations-of-pathogenicity, uncertain-significance, likely-benign Coding sequence variant, missense variant
rs121434500 G>A Likely-pathogenic, pathogenic Coding sequence variant, missense variant
rs139532210 C>G,T Conflicting-interpretations-of-pathogenicity, uncertain-significance, likely-benign, benign Intron variant
rs141724500 G>A,T Conflicting-interpretations-of-pathogenicity, uncertain-significance, likely-benign Coding sequence variant, missense variant
rs144860423 G>A Conflicting-interpretations-of-pathogenicity, uncertain-significance, likely-benign Missense variant, coding sequence variant
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022575 hsa-miR-124-3p Microarray 18668037
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002027 Process Regulation of heart rate IMP 18591664
GO:0003117 Process Regulation of vasoconstriction by circulating norepinephrine IEA
GO:0003779 Function Actin binding IEA
GO:0005198 Function Structural molecule activity IEA
GO:0005515 Function Protein binding IPI 10212242, 16192269, 16533813, 18468998, 19931615, 26617989, 27382054
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q13424
Protein name Alpha-1-syntrophin (59 kDa dystrophin-associated protein A1 acidic component 1) (Pro-TGF-alpha cytoplasmic domain-interacting protein 1) (TACIP1) (Syntrophin-1)
Protein function Adapter protein that binds to and probably organizes the subcellular localization of a variety of membrane proteins. May link various receptors to the actin cytoskeleton and the extracellular matrix via the dystrophin glycoprotein complex. Plays
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00595 PDZ
87 167
PDZ domain
Domain
PF18012 PH_17
208 266
PH domain
Domain
PF00169 PH
294 401
PH domain
Domain
Sequence
MASGRRAPRTGLLELRAGAGSGAGGERWQRVLLSLAEDVLTVSPADGDPGPEPGAPREQE
PAQLNGAAEPGAGPPQLPEALLLQRRRVTVRKADAGGLGISIKGGRENKMPILISKIFKG
LAADQTEALFVGDAILSVNGEDLSSATHDEAVQVLKKTGKEVVLEVK
YMKDVSPYFKNST
GGTSVGWDSPPASPLQRQPSSPGPTPRNFSEAKHMSLKMAYVSKRCTPNDPEPRYLEICS
ADGQDTLFLRAKDEASARSWATAIQA
QVNTLTPRVKDELQALLAATSTAGSQDIKQIGWL
TEQLPSGGTAPTLALLTEKELLLYLSLPETREALSRPARTAPLIATRLVHSGPSKGSVPY
DAELSFALRTGTRHGVDTHLFSVESPQELAAWTRQLVDGCH
RAAEGVQEVSTACTWNGRP
CSLSVHIDKGFTLWAAEPGAARAVLLRQPFEKLQMSSDDGASLLFLDFGGAEGEIQLDLH
SCPKTIVFIIHSFLSAKVTRLGLLA
Sequence length 505
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
  Cytoskeleton in muscle cells
Hypertrophic cardiomyopathy
Arrhythmogenic right ventricular cardiomyopathy
Dilated cardiomyopathy
Viral myocarditis
 
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Atrial fibrillation Atrial Fibrillation rs120074192, rs121908590, rs121908593, rs121434558, rs587776851, rs387906612, rs387906613, rs387906614, rs387906615, rs199472687, rs199472705, rs199473324, rs587777336, rs587777339, rs587777557, rs587777558, rs587777559, rs587777560, rs886037778, rs769405762, rs770372675
Dysautonomia Dysautonomia rs111033171, rs137853022, rs28939712, rs754348901, rs749052963, rs1057517169, rs1057516865, rs763445509, rs767527819, rs781333644, rs1239081703, rs1554696574, rs539544212, rs1201626345, rs774890086, rs1554703061, rs1554703613, rs1319053366, rs1554703851, rs868073099, rs926177767, rs376078668, rs1554695299, rs1554696648, rs1554696934, rs1554699327, rs1554691572, rs1554695846, rs1554697001, rs770668926, rs1554698037, rs759412460, rs1554702142, rs765572951, rs1554702880, rs1554703831, rs760774999, rs1554696650, rs757972943, rs1554703874, rs1554703907, rs571348995
Long qt syndrome Long QT Syndrome, Long Qt Syndrome 12 rs121434386, rs120074177, rs104894252, rs120074181, rs120074182, rs120074178, rs120074179, rs120074180, rs12720459, rs120074183, rs120074184, rs120074185, rs120074186, rs17215500, rs120074188, rs387906290, rs1800171, rs120074189, rs120074190, rs120074191, rs120074193, rs120074194, rs120074196, rs116840805, rs116840789, rs116840778, rs1008642, rs104893713, rs104893715, rs121909281, rs28937316, rs28937317, rs137854613, rs137854614, rs137854600, rs137854601, rs397514449, rs137854618, rs121918602, rs281865421, rs28933384, rs121912504, rs121912505, rs28928904, rs121912506, rs1554426258, rs121912507, rs121912508, rs9333649, rs28928905, rs121912509, rs121912510, rs121912511, rs121912512, rs1554424772, rs121912516, rs28933093, rs79891110, rs80315385, rs199472944, rs199472942, rs199476324, rs116840787, rs193922365, rs151344631, rs45546039, rs397507556, rs199472758, rs199472759, rs397508068, rs397508069, rs199472760, rs199472762, rs199472763, rs397508070, rs397508071, rs199473471, rs199472765, rs397508072, rs397508075, rs12720458, rs199473411, rs199473410, rs199473663, rs199472767, rs397508077, rs397508078, rs199472771, rs397508082, rs397508083, rs397508085, rs397508087, rs397508090, rs397508091, rs397508093, rs397508096, rs199473479, rs199472790, rs397508097, rs138551008, rs199472795, rs199473480, rs199472800, rs199472804, rs199472805, rs199472807, rs199472806, rs397508099, rs199473483, rs199472814, rs199472815, rs397508103, rs397508104, rs199472678, rs199473448, rs199472679, rs397508110, rs397508111, rs397508112, rs397508113, rs179489, rs397508114, rs199472693, rs139042529, rs199472696, rs199472697, rs397508115, rs199473394, rs199473397, rs397508116, rs397508117, rs199473662, rs397508118, rs397508120, rs199472702, rs199473456, rs199472708, rs199473457, rs199472709, rs199472710, rs199472712, rs199472713, rs199472716, rs199472719, rs199472720, rs199472722, rs199472721, rs397508125, rs199473460, rs199472726, rs199472727, rs397508126, rs397508127, rs199472730, rs199473462, rs397508129, rs199473466, rs397508130, rs199472743, rs199472745, rs199472748, rs74462309, rs104894255, rs199472749, rs199472751, rs199473470, rs199472754, rs199472755, rs199472756, rs397508134, rs199472794, rs199472801, rs199472687, rs199473661, rs199473398, rs199472701, rs199472823, rs199472705, rs199472706, rs199473459, rs199472718, rs199472734, rs199472740, rs199472750, rs199472753, rs199472895, rs199472836, rs199472911, rs199472912, rs199472916, rs199472918, rs199472919, rs199472845, rs199472921, rs199472922, rs199472926, rs199473423, rs199473413, rs199473426, rs199473428, rs199472934, rs199472936, rs199473522, rs199472939, rs199472941, rs199473524, rs199472945, rs199472946, rs199472947, rs199472948, rs199472950, rs199472953, rs199472954, rs199473039, rs199472957, rs41307295, rs199472961, rs199472968, rs199472970, rs199472971, rs199472979, rs199473665, rs199473419, rs199473420, rs199473421, rs199472986, rs199472990, rs199472995, rs199472999, rs199473538, rs199473005, rs199473004, rs199473018, rs199472859, rs199472862, rs199472830, rs199472884, rs199473108, rs72549410, rs199473584, rs199473225, rs199473623, rs199473631, rs199473311, rs199473072, rs386352319, rs398124647, rs398124648, rs398124650, rs398124649, rs199473354, rs587777437, rs587782933, rs189014161, rs730880374, rs730880116, rs730880043, rs730882252, rs199744595, rs730882253, rs730882254, rs786204101, rs786204395, rs786204839, rs786205745, rs786205748, rs786205753, rs794728721, rs794728740, rs794728783, rs749697698, rs397514251, rs1553694247, rs794728849, rs794728473, rs794728470, rs794728466, rs794728469, rs794728468, rs794728467, rs794728403, rs794728504, rs794728401, rs794728464, rs748706373, rs794728459, rs794728462, rs794728503, rs794728458, rs794728399, rs794728456, rs794728455, rs794728502, rs794728449, rs794728446, rs1554425149, rs794728391, rs794728382, rs794728381, rs1137617, rs794728488, rs794728380, rs794728487, rs794728442, rs794728377, rs794728483, rs794728440, rs794728481, rs794728438, rs201268831, rs794728498, rs794728366, rs794728478, rs794728365, rs770047651, rs794728364, rs794728431, rs794728429, rs794728427, rs794728422, rs794728425, rs794728496, rs794728423, rs794728420, rs761863251, rs794728489, rs754921704, rs794728508, rs794728409, rs794728506, rs794728475, rs794728406, rs794728416, rs794728563, rs1554958092, rs397508109, rs794728549, rs794728565, rs794728566, rs762814879, rs794728547, rs794728580, rs794728569, rs775479779, rs794728517, rs794728581, rs794728523, rs794728571, rs794728527, rs775537394, rs794728558, rs794728561, rs794728531, rs794728535, rs794728562, rs794728576, rs794728537, rs794728540, rs779760381, rs796052171, rs755287627, rs796052197, rs796052198, rs796052196, rs796052199, rs796052200, rs796052166, rs878854347, rs794728568, rs878854349, rs878854350, rs878854348, rs863224478, rs863225288, rs864622309, rs864622174, rs773724817, rs199473441, rs199472951, rs869025448, rs869025447, rs878853771, rs199473412, rs763462603, rs886037906, rs886039183, rs886039045, rs530612385, rs886039385, rs750349088, rs199472893, rs773204795, rs1057518151, rs1057517743, rs1057517742, rs1057517711, rs1057520558, rs1057520598, rs1057520623, rs746877365, rs1060500662, rs1060500661, rs1060500670, rs1554425527, rs1060500621, rs199956744, rs1060500628, rs765169367, rs1060500626, rs1060500627, rs1060500623, rs1060500629, rs397508105, rs786205771, rs1060502608, rs1060502607, rs756159737, rs1554424044, rs1064793434, rs1064794793, rs1064793832, rs794728477, rs199472844, rs1554958132, rs1064795333, rs1064793159, rs1085307620, rs1554425498, rs1554425569, rs1131691762, rs1131692183, rs1131692327, rs199473442, rs1135401944, rs886039043, rs1555843898, rs199473310, rs1554423863, rs1554920580, rs1435990592, rs1554892994, rs1554894448, rs1554424079, rs1554426219, rs1554427317, rs1554428173, rs1554424062, rs1554425320, rs1554425486, rs1554424083, rs1554425226, rs1554425284, rs1554893228, rs1555814427, rs1553431702, rs1554424688, rs1553698563, rs1554424063, rs1554430908, rs1554423871, rs1554424070, rs1554424091, rs1554424390, rs1554424620, rs1385959174, rs1554424849, rs1554426244, rs1554427596, rs1554430850, rs1554893091, rs199472833, rs1554894445, rs1554424138, rs1554427931, rs1554958043, rs1554428170, rs1554427943, rs1554431441, rs1554424671, rs199473517, rs1554895166, rs1555843953, rs758346045, rs1244688796, rs779124360, rs1564821090, rs1563152963, rs1563156868, rs1325525794, rs199472924, rs1563193513, rs1558693760, rs761585108, rs1563156461, rs1564067737, rs199473430, rs1563161565, rs1563169296, rs1564820729, rs397508133, rs199472770, rs1564886323, rs1564820372, rs1564820786, rs1564824264, rs1564886349, rs1563148264, rs749211387, rs1563160541, rs1564825414, rs1568835906, rs1563161538, rs750835733, rs1568469857, rs1569139160, rs199473259, rs1584843033, rs1590081467, rs1584885912, rs1573214371, rs1584841841, rs1584842021, rs1584845263, rs1584846819, rs1584850710, rs1584856544, rs1584883087, rs1584883377, rs1584883517, rs1589884185, rs1589957719, rs1589957756, rs1589957233, rs1584852351, rs1590081328, rs794728578, rs1589931156, rs1584843078, rs1584847173, rs1584855956, rs552508881, rs1584852174, rs1589968661, rs1599759554, rs1599759598, rs1573214163, rs1584863723, rs1589957697, rs1800946921, rs1800958758, rs1801008727, rs1801183828, rs1801406108, rs1801444435, rs1801462423, rs1801935667, rs1848344878, rs1848346228, rs1848360153, rs1554894743, rs1848613641, rs199472974, rs1801941580, rs775362401, rs1846542419, rs1848316236, rs1848322089, rs767921776 18591664, 16301704, 19684871
Ventricular fibrillation Ventricular Fibrillation rs137854604, rs587782933, rs190140598
Unknown
Disease name Disease term dbSNP ID References
Grand mal status epilepticus Grand Mal Status Epilepticus 20886625
Nonconvulsive status epilepticus Non-Convulsive Status Epilepticus 20886625
Petit mal status Petit mal status 20886625
Romano-ward syndrome Romano-Ward Syndrome 24093767

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412