BNIP3 (BCL2 interacting protein 3)

Gene

• Entrez ID: 664
• Gene name: BCL2 interacting protein 3
• Gene symbol: BNIP3
• Synonyms: HABON, NIP3
• Chromosome: 10
• Chromosome location: 10q26.3
• Summary: This gene is encodes a mitochondrial protein that contains a BH3 domain and acts as a pro-apoptotic factor. The encoded protein interacts with anti-apoptotic proteins, including the E1B 19 kDa protein and Bcl2. This gene is silenced in tumors by DNA methy

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000305	hsa-miR-145-5p	Luciferase reporter assay, qRT-PCR, Western blot	20332243
MIRT000305	hsa-miR-145-5p	Luciferase reporter assay, qRT-PCR, Western blot	20332243
MIRT000305	hsa-miR-145-5p	Luciferase reporter assay	20332243
MIRT004753	hsa-miR-221-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	20018759
MIRT000305	hsa-miR-145-5p	Microarray, qRT-PCR	22815788
MIRT437693	hsa-miR-27a-3p	Microarray, qRT-PCR	22815788
MIRT437701	hsa-miR-27b-3p	Microarray, qRT-PCR	22815788
MIRT437785	hsa-miR-210-3p	Luciferase reporter assay, qRT-PCR, Western blot	23688833
MIRT437693	hsa-miR-27a-3p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), qRT-PCR	31923741
MIRT437785	hsa-miR-210-3p	Microarray, qRT-PCR	35816043
MIRT823404	hsa-miR-103a	CLIP-seq
MIRT823405	hsa-miR-107	CLIP-seq
MIRT823406	hsa-miR-1204	CLIP-seq
MIRT823407	hsa-miR-1267	CLIP-seq
MIRT823408	hsa-miR-214	CLIP-seq
MIRT823409	hsa-miR-3610	CLIP-seq
MIRT823410	hsa-miR-3619-5p	CLIP-seq
MIRT823411	hsa-miR-3674	CLIP-seq
MIRT823412	hsa-miR-3914	CLIP-seq
MIRT823413	hsa-miR-4291	CLIP-seq
MIRT823414	hsa-miR-4297	CLIP-seq
MIRT823415	hsa-miR-4310	CLIP-seq
MIRT823416	hsa-miR-4520a-3p	CLIP-seq
MIRT823417	hsa-miR-4520b-3p	CLIP-seq
MIRT823418	hsa-miR-4529-3p	CLIP-seq
MIRT823419	hsa-miR-4652-3p	CLIP-seq
MIRT823420	hsa-miR-4682	CLIP-seq
MIRT823421	hsa-miR-4685-5p	CLIP-seq
MIRT823422	hsa-miR-4701-5p	CLIP-seq
MIRT823423	hsa-miR-548a-3p	CLIP-seq
MIRT823424	hsa-miR-548a-5p	CLIP-seq
MIRT823425	hsa-miR-548ab	CLIP-seq
MIRT823426	hsa-miR-548ak	CLIP-seq
MIRT823427	hsa-miR-548b-5p	CLIP-seq
MIRT823428	hsa-miR-548c-5p	CLIP-seq
MIRT823429	hsa-miR-548d-5p	CLIP-seq
MIRT823430	hsa-miR-548e	CLIP-seq
MIRT823431	hsa-miR-548f	CLIP-seq
MIRT823432	hsa-miR-548h	CLIP-seq
MIRT823433	hsa-miR-548i	CLIP-seq
MIRT823434	hsa-miR-548j	CLIP-seq
MIRT823435	hsa-miR-548k	CLIP-seq
MIRT823436	hsa-miR-548l	CLIP-seq
MIRT823437	hsa-miR-548w	CLIP-seq
MIRT823438	hsa-miR-548y	CLIP-seq
MIRT823439	hsa-miR-559	CLIP-seq
MIRT823440	hsa-miR-562	CLIP-seq
MIRT823441	hsa-miR-588	CLIP-seq
MIRT823442	hsa-miR-761	CLIP-seq
MIRT823443	hsa-miR-922	CLIP-seq
MIRT1545774	hsa-miR-128	CLIP-seq
MIRT1545775	hsa-miR-27a	CLIP-seq
MIRT1545776	hsa-miR-27b	CLIP-seq
MIRT1545777	hsa-miR-3647-3p	CLIP-seq
MIRT1545778	hsa-miR-411	CLIP-seq
MIRT1545779	hsa-miR-4282	CLIP-seq
MIRT1545780	hsa-miR-4699-3p	CLIP-seq
MIRT1545781	hsa-miR-5096	CLIP-seq
MIRT1545782	hsa-miR-513a-5p	CLIP-seq
MIRT1545783	hsa-miR-936	CLIP-seq
MIRT823407	hsa-miR-1267	CLIP-seq
MIRT1943469	hsa-miR-1298	CLIP-seq
MIRT823411	hsa-miR-3674	CLIP-seq
MIRT1943470	hsa-miR-3678-3p	CLIP-seq
MIRT1943471	hsa-miR-410	CLIP-seq
MIRT1943472	hsa-miR-4276	CLIP-seq
MIRT823419	hsa-miR-4652-3p	CLIP-seq
MIRT1943473	hsa-miR-4680-3p	CLIP-seq
MIRT823420	hsa-miR-4682	CLIP-seq
MIRT1943474	hsa-miR-4775	CLIP-seq
MIRT1943475	hsa-miR-590-3p	CLIP-seq
MIRT1943476	hsa-miR-664	CLIP-seq
MIRT2182094	hsa-miR-1276	CLIP-seq
MIRT2182095	hsa-miR-145	CLIP-seq
MIRT2182096	hsa-miR-197	CLIP-seq
MIRT2182097	hsa-miR-2467-3p	CLIP-seq
MIRT2182098	hsa-miR-3180-5p	CLIP-seq
MIRT2182099	hsa-miR-3591-5p	CLIP-seq
MIRT2182100	hsa-miR-3660	CLIP-seq
MIRT823411	hsa-miR-3674	CLIP-seq
MIRT1943470	hsa-miR-3678-3p	CLIP-seq
MIRT2182101	hsa-miR-3691-3p	CLIP-seq
MIRT2182102	hsa-miR-3925-3p	CLIP-seq
MIRT1545778	hsa-miR-411	CLIP-seq
MIRT1943472	hsa-miR-4276	CLIP-seq
MIRT2182103	hsa-miR-4277	CLIP-seq
MIRT2182104	hsa-miR-4280	CLIP-seq
MIRT2182105	hsa-miR-4311	CLIP-seq
MIRT2182106	hsa-miR-4328	CLIP-seq
MIRT2182107	hsa-miR-4494	CLIP-seq
MIRT2182108	hsa-miR-4526	CLIP-seq
MIRT823420	hsa-miR-4682	CLIP-seq
MIRT2182109	hsa-miR-4684-3p	CLIP-seq
MIRT2182110	hsa-miR-4765	CLIP-seq
MIRT1943474	hsa-miR-4775	CLIP-seq
MIRT2182111	hsa-miR-4781-3p	CLIP-seq
MIRT2182112	hsa-miR-499a-5p	CLIP-seq
MIRT2182113	hsa-miR-508-5p	CLIP-seq
MIRT823424	hsa-miR-548a-5p	CLIP-seq
MIRT823425	hsa-miR-548ab	CLIP-seq
MIRT823426	hsa-miR-548ak	CLIP-seq
MIRT823427	hsa-miR-548b-5p	CLIP-seq
MIRT823428	hsa-miR-548c-5p	CLIP-seq
MIRT823429	hsa-miR-548d-5p	CLIP-seq
MIRT823432	hsa-miR-548h	CLIP-seq
MIRT823433	hsa-miR-548i	CLIP-seq
MIRT823434	hsa-miR-548j	CLIP-seq
MIRT823435	hsa-miR-548k	CLIP-seq
MIRT823436	hsa-miR-548l	CLIP-seq
MIRT823437	hsa-miR-548w	CLIP-seq
MIRT823438	hsa-miR-548y	CLIP-seq
MIRT823439	hsa-miR-559	CLIP-seq
MIRT2182114	hsa-miR-583	CLIP-seq
MIRT1943475	hsa-miR-590-3p	CLIP-seq
MIRT2182115	hsa-miR-622	CLIP-seq
MIRT2182116	hsa-miR-640	CLIP-seq
MIRT2182117	hsa-miR-759	CLIP-seq
MIRT2182118	hsa-miR-944	CLIP-seq
MIRT823404	hsa-miR-103a	CLIP-seq
MIRT823405	hsa-miR-107	CLIP-seq
MIRT2182099	hsa-miR-3591-5p	CLIP-seq
MIRT823412	hsa-miR-3914	CLIP-seq
MIRT823415	hsa-miR-4310	CLIP-seq
MIRT2485680	hsa-miR-4731-3p	CLIP-seq
MIRT2485681	hsa-miR-4796-5p	CLIP-seq
MIRT2485682	hsa-miR-4801	CLIP-seq
MIRT2182116	hsa-miR-640	CLIP-seq
MIRT2182118	hsa-miR-944	CLIP-seq
MIRT823404	hsa-miR-103a	CLIP-seq
MIRT823405	hsa-miR-107	CLIP-seq
MIRT2182099	hsa-miR-3591-5p	CLIP-seq
MIRT823412	hsa-miR-3914	CLIP-seq
MIRT823415	hsa-miR-4310	CLIP-seq
MIRT2485680	hsa-miR-4731-3p	CLIP-seq
MIRT2485681	hsa-miR-4796-5p	CLIP-seq
MIRT2485682	hsa-miR-4801	CLIP-seq
MIRT2182116	hsa-miR-640	CLIP-seq
MIRT2182118	hsa-miR-944	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
HIF1A	Activation	17848618
HIF1A	Unknown	17513511

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000422	Process	Autophagy of mitochondrion	NAS	22505714
GO:0001666	Process	Response to hypoxia	ISS
GO:0005515	Function	Protein binding	IPI	7954800, 10381623, 15868100, 16189514, 17360363, 18371312, 19060904, 20436456, 21516116, 22292033, 24981860, 25416956, 27107012, 27499296, 28514442, 32296183
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	ISS
GO:0005635	Component	Nuclear envelope	IBA	21873635
GO:0005635	Component	Nuclear envelope	IDA	7954800
GO:0005654	Component	Nucleoplasm	ISS
GO:0005737	Component	Cytoplasm	ISS
GO:0005739	Component	Mitochondrion	IDA	7954800, 9396766, 18371312
GO:0005739	Component	Mitochondrion	TAS	9973195
GO:0005741	Component	Mitochondrial outer membrane	IBA	21873635
GO:0005741	Component	Mitochondrial outer membrane	IDA	22292033
GO:0005783	Component	Endoplasmic reticulum	IBA	21873635
GO:0005783	Component	Endoplasmic reticulum	NAS	22505714
GO:0006915	Process	Apoptotic process	IPI	7954800
GO:0008219	Process	Cell death	ISS
GO:0009617	Process	Response to bacterium	IEA
GO:0010508	Process	Positive regulation of autophagy	TAS	18309324
GO:0010637	Process	Negative regulation of mitochondrial fusion	IDA	20436456
GO:0010659	Process	Cardiac muscle cell apoptotic process	IEA
GO:0010666	Process	Positive regulation of cardiac muscle cell apoptotic process	IEA
GO:0010917	Process	Negative regulation of mitochondrial membrane potential	IEA
GO:0010940	Process	Positive regulation of necrotic cell death	IEA
GO:0014069	Component	Postsynaptic density	IEA
GO:0016032	Process	Viral process	IEA
GO:0016239	Process	Positive regulation of macroautophagy	IGI	19273585
GO:0021987	Process	Cerebral cortex development	IEA
GO:0030425	Component	Dendrite	ISS
GO:0031307	Component	Integral component of mitochondrial outer membrane	IDA	10891486
GO:0031966	Component	Mitochondrial membrane	IDA	10891486
GO:0031966	Component	Mitochondrial membrane	IMP	9396766
GO:0035694	Process	Mitochondrial protein catabolic process	IMP	22292033
GO:0042802	Function	Identical protein binding	IPI	10381623, 16189514, 25416956, 27107012, 32296183
GO:0042803	Function	Protein homodimerization activity	IDA	9396766, 10381623
GO:0043065	Process	Positive regulation of apoptotic process	IDA	9973195, 10381623
GO:0043066	Process	Negative regulation of apoptotic process	TAS	7954800
GO:0043067	Process	Regulation of programmed cell death	IBA	21873635
GO:0043068	Process	Positive regulation of programmed cell death	IBA	21873635
GO:0043068	Process	Positive regulation of programmed cell death	IDA	10891486
GO:0043243	Process	Positive regulation of protein-containing complex disassembly	IDA	20436456
GO:0043653	Process	Mitochondrial fragmentation involved in apoptotic process	IDA	20436456
GO:0045837	Process	Negative regulation of membrane potential	IDA	10891486
GO:0046902	Process	Regulation of mitochondrial membrane permeability	IDA	10891486
GO:0048102	Process	Autophagic cell death	IEA
GO:0048678	Process	Response to axon injury	IEA
GO:0048709	Process	Oligodendrocyte differentiation	IEA
GO:0050873	Process	Brown fat cell differentiation	IEA
GO:0051020	Function	GTPase binding	IPI	20436456
GO:0051402	Process	Neuron apoptotic process	ISS
GO:0051561	Process	Positive regulation of mitochondrial calcium ion concentration	IEA
GO:0051607	Process	Defense response to virus	IDA	9973195
GO:0055093	Process	Response to hyperoxia	IEA
GO:0060548	Process	Negative regulation of cell death	IGI	19273585
GO:0070301	Process	Cellular response to hydrogen peroxide	IEA
GO:0071260	Process	Cellular response to mechanical stimulus	IEP
GO:0071279	Process	Cellular response to cobalt ion	IMP	20436456
GO:0071456	Process	Cellular response to hypoxia	IGI	19273585
GO:0071456	Process	Cellular response to hypoxia	IMP	20436456
GO:0072593	Process	Reactive oxygen species metabolic process	IDA	10891486
GO:0090141	Process	Positive regulation of mitochondrial fission	IDA	20436456
GO:0090200	Process	Positive regulation of release of cytochrome c from mitochondria	IDA	20436456
GO:0090649	Process	Response to oxygen-glucose deprivation	IEA
GO:0097345	Process	Mitochondrial outer membrane permeabilization	IBA	21873635
GO:0097345	Process	Mitochondrial outer membrane permeabilization	IDA	18371312
GO:0140507	Process	Granzyme-mediated programmed cell death signaling pathway	IDA	9396766
GO:1901998	Process	Toxin transport	IEA
GO:1902109	Process	Negative regulation of mitochondrial membrane permeability involved in apoptotic process	IEA
GO:1903599	Process	Positive regulation of autophagy of mitochondrion	IEA
GO:1903715	Process	Regulation of aerobic respiration	IEA
GO:1990144	Process	Intrinsic apoptotic signaling pathway in response to hypoxia	IMP	20436456
GO:2000378	Process	Negative regulation of reactive oxygen species metabolic process	IEA

Other IDs

• MIM: 603293
• HGNC: 1084
• e!Ensembl: ENSG00000176171

Protein

• UniProt ID: Q12983
• Protein name: BCL2/adenovirus E1B 19 kDa protein-interacting protein 3
• Protein function: Apoptosis-inducing protein that can overcome BCL2 suppression. May play a role in repartitioning calcium between the two major intracellular calcium stores in association with BCL2. Involved in mitochondrial quality control via its interaction w
• PDB: 2J5D, 2KA1, 2KA2
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF06553	BNIP3	68 → 259	BNIP3	Family

• Sequence:

  MGDAAADPPGPALPCEFLRPGCGAPLSPGAQLGRGAPTSAFPPPAAEAHPAARRGLRSPQ
  LPSGAMSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESG
  RSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSD
  WIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSAEFLKVFLPSLLLSHLL
  AIGLGIYIGRRLTTSTSTF

• Sequence length: 259

Pathways

KEGG:

FoxO signaling pathway
Mitophagy - animal
Autophagy - animal
Shigellosis
Legionellosis

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Gastric cancer	Hereditary Diffuse Gastric Cancer	rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802, rs28933369, rs121912469, rs80358011, rs397507262, rs80359439, rs397507333, rs80359543, rs80358831, rs80359596, rs80358920, rs80358972, rs80359659, rs397507404, rs397514661, rs80359516, rs200495564, rs80358419, rs80359274, rs80359283, rs80358427, rs80358428, rs80358435, rs81002805, rs397507660, rs397507663, rs80359391, rs80359443, rs81002797, rs80359466, rs397507752, rs80359484, rs80359603, rs397507954, rs80359058, rs80359071, rs397507981, rs80359121, rs80357086, rs80357064, rs397508936, rs80357695, rs80357661, rs397509035, rs80357544, rs80357577, rs80357881, rs80357296, rs80356923, rs80356866, rs80357504, rs80357390, rs80357239, rs80358099, rs397509284, rs80357258, rs199474738, rs199474747, rs587779204, rs63750439, rs267608076, rs587779246, rs63749999, rs267608078, rs63751327, rs267607719, rs267607734, rs63750706, rs63751711, rs587779047, rs587779075, rs267607949, rs63750633, rs63750803, rs63751618, rs267608154, rs200640585, rs80358018, rs80357857, rs80357882, rs180177103, rs587779815, rs587779865, rs587779872, rs587780059, rs121912666, rs587780088, rs587780104, rs200432447, rs180177100, rs587780226, rs587780784, rs587776416, rs587781276, rs587781629, rs587781694, rs587781727, rs587781730, rs587781807, rs587781894, rs587781948, rs121913344, rs587782292, rs587782350, rs587782558, rs587782719, rs587782885, rs587783057, rs730881833, rs730881411, rs730881336, rs139770721, rs730881869, rs730881633, rs730882007, rs786203115, rs765123255, rs1553333738, rs762083530, rs786202800, rs17174393, rs55996097, rs750621215, rs786203451, rs747604569, rs764389018, rs786204433, rs786204862, rs772821016, rs779582317, rs863225406, rs193922343, rs759965045, rs63749919, rs760228510, rs746481984, rs762307622, rs876659736, rs876660933, rs747727055, rs1450394308, rs876658348, rs876658431, rs876659326, rs876660444, rs730881369, rs878853865, rs753862052, rs587780024, rs138941496, rs886040739, rs886040744, rs886040347, rs878854957, rs886040123, rs398122662, rs886040942, rs1057517104, rs1057516320, rs1057516683, rs879254046, rs1057517253, rs587781927, rs985033810, rs1057519989, rs775464903, rs374230313, rs758304323, rs1060501599, rs758081262, rs1060500126, rs1060502734, rs587776408, rs1060501695, rs1114167816, rs1114167596, rs1114167667, rs1555460315, rs1135402788, rs1554086196, rs730881919, rs773356478, rs769237459, rs1553653158, rs587782087, rs1555107263, rs1555119940, rs1403784434, rs1342519012, rs751710099, rs1553616361, rs1553619721, rs1270783041, rs775036118, rs1555288557, rs1555460548, rs1555461154, rs1298667185, rs1553622218, rs63751101, rs1349928568, rs771936821, rs1021662947, rs1555921011, rs81002831, rs1555124506, rs1555574803, rs1060502716, rs1555605362, rs747057367, rs1565385010, rs1567554500, rs1567516230, rs1558644995, rs1555591308, rs778306619, rs1566231194, rs1603328466, rs1570406302, rs1586108714, rs768362387, rs1597713777, rs1060502926, rs1597867185, rs1591517571, rs1591663236, rs1593903006, rs1555284779, rs1597096243, rs45459799, rs1597360340, rs587781905, rs864622481, rs1601753141, rs1966858562, rs1966967065, rs1967016153, rs1967113484, rs2080473458, rs1591387978, rs1224428422, rs1597747184, rs2082309297, rs2051929740, rs147542208	16367923
Multiple myeloma	Multiple Myeloma	rs11540652, rs78311289, rs121913482, rs397507340, rs121913343, rs121913240, rs121913529, rs730882018, rs1057517992, rs121913527, rs756183569, rs746646631, rs1574706907, rs372078034, rs745380962, rs751524927, rs1575079076, rs1575446356, rs1478603808, rs1578264146, rs1578673280, rs1579484570, rs1579491104, rs1171390403, rs1582867955, rs764264135, rs951047896, rs890521687, rs1581495906, rs1587941402, rs1003155450, rs1588299621, rs1591100766, rs1591693095, rs1029296641, rs1593107841, rs1208575764, rs1593835248, rs1594406727, rs1594966387, rs1595889508, rs1159294530, rs1597073318, rs1135402871, rs1599413207, rs1418268495, rs1212577459, rs1600394490, rs1455074519, rs1603113792, rs1603415028, rs1602247047, rs1603452612	18172295
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	18163427

Unknown
Disease name	Disease term	dbSNP ID	References
Prostatic neoplasms	Prostatic Neoplasms		18163427
Stomach neoplasms	Malignant neoplasm of stomach, Stomach Neoplasms		16367923