BNIP1 (BCL2 interacting protein 1)

Gene

• Entrez ID: 662
• Gene name: BCL2 interacting protein 1
• Gene symbol: BNIP1
• Synonyms: NIP1, SEC20, TRG-8
• Chromosome: 5
• Chromosome location: 5q35.1
• Summary: This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein, which protects cells from virally-induced cell death. The encoded protein also interacts with E1B 19 kDa-like sequences of

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT735792	hsa-miR-20a-5p	qRT-PCR	32864858

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005484	Function	SNAP receptor activity	IDA	15272311
GO:0005515	Function	Protein binding	IPI	7954800, 15272311, 21931693, 23896122, 32296183
GO:0005635	Component	Nuclear envelope	IDA	7954800
GO:0005737	Component	Cytoplasm	IDA	7954800
GO:0005783	Component	Endoplasmic reticulum	IBA	21873635
GO:0005783	Component	Endoplasmic reticulum	IDA	15272311
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	23896122
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006890	Process	Retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	IBA	21873635
GO:0006890	Process	Retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	TAS
GO:0006915	Process	Apoptotic process	IPI	7954800
GO:0007029	Process	Endoplasmic reticulum organization	IMP	15272311
GO:0014823	Process	Response to activity	IEA
GO:0016032	Process	Viral process	IEA
GO:0016320	Process	Endoplasmic reticulum membrane fusion	IMP	15272311
GO:0030137	Component	COPI-coated vesicle	IEA
GO:0030176	Component	Integral component of endoplasmic reticulum membrane	TAS	15272311
GO:0031201	Component	SNARE complex	IBA	21873635
GO:0031201	Component	SNARE complex	IDA	15272311
GO:0031966	Component	Mitochondrial membrane	IDA	21931693, 23896122
GO:0042594	Process	Response to starvation	IEA
GO:0043066	Process	Negative regulation of apoptotic process	TAS	7954800
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA	7954800
GO:0090649	Process	Response to oxygen-glucose deprivation	IEA
GO:0097194	Process	Execution phase of apoptosis	IC	15272311

Other IDs

• MIM: 603291
• HGNC: 1082
• e!Ensembl: ENSG00000113734

Protein

• UniProt ID: Q12981
• Protein name: Vesicle transport protein SEC20 (BCL2/adenovirus E1B 19 kDa protein-interacting protein 1) (Transformation-related gene 8 protein) (TRG-8)
• Protein function: As part of a SNARE complex may be involved in endoplasmic reticulum membranes fusion and be required for the maintenance of endoplasmic reticulum organization (PubMed:15272311). Also plays a role in apoptosis (PubMed:15272311, PubMed:23896122, P
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03908	Sec20	133 → 224	Sec20	Family

• Sequence:

  MAAPQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPLSALTELNTKVKEKFQQLRHRIQD
  LEQLAKEQDKESEKQLLLQEVENHKKQMLSNQASWRKANLTCKIAIDNLEKAELLQGGDL
  LRQRKTTKESLAQTSSTITESLMGISRMMAQQVQQSEEAMQSLVTSSRTILDANEEFKSM
  SGTIQLGRKLITKYNRRELTDKLLIFLALALFLATVLYIVKKRLFPFL

• Sequence length: 228

Pathways

KEGG:

SNARE interactions in vesicular transport

Reactome:

COPI-dependent Golgi-to-ER retrograde traffic

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Glaucoma	Glaucoma, Open-Angle	rs121918355, rs1566660365, rs1566635134, rs121918356, rs1566634475, rs28936700, rs55771538, rs28936701, rs104893622, rs55989760, rs72549387, rs104893628, rs2125316417, rs104893629, rs74315328, rs121909193, rs74315330, rs74315329, rs74315332, rs74315334, rs74315336, rs74315338, rs74315341, rs121909194, rs74315331, rs1558603396, rs387907175, rs587778873, rs587778875, rs104894979, rs137854895, rs766425037, rs72549380, rs148542782, rs541217363, rs753021890, rs771076928, rs56010818, rs777678299, rs1446110883, rs1573274915, rs1587545234, rs751768343, rs944452644	29891935

Unknown
Disease name	Disease term	dbSNP ID	References
Congenital hypertrophic pyloric stenosis	Pyloric Stenosis, Hypertrophic		22306654