GediPNet logo

SMARCD2 (SWI/SNF related BAF chromatin remodeling complex subunit D2)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6603
Gene nameGene Name - the full gene name approved by the HGNC.
SWI/SNF related BAF chromatin remodeling complex subunit D2
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
SMARCD2
SynonymsGene synonyms aliases
BAF60B, CRACD2, PRO2451, Rsc6p, SGD2
ChromosomeChromosome number
17
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q23.3
SummarySummary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. T
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs112986541 C>G,T Likely-pathogenic Splice acceptor variant
rs1057518731 C>T Pathogenic Splice donor variant
rs1057518733 A>G Pathogenic Splice donor variant
rs1555580263 ->AGGTAGAACCTTATCTGCCATCTTC Pathogenic Stop gained, coding sequence variant, inframe indel
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004999 hsa-miR-125b-5p Microarray 17891175
MIRT020668 hsa-miR-155-5p Proteomics 18668040
MIRT049267 hsa-miR-92a-3p CLASH 23622248
MIRT049267 hsa-miR-92a-3p CLASH 23622248
MIRT043231 hsa-miR-324-5p CLASH 23622248
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin HDA 16217013
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IBA 21873635
GO:0003713 Function Transcription coactivator activity NAS 8804307
GO:0005515 Function Protein binding IPI 20148946
GO:0005634 Component Nucleus IBA 21873635
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q92925
Protein name SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2 (60 kDa BRG-1/Brm-associated factor subunit B) (BRG1-associated factor 60B) (BAF60B)
Protein function Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromati
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02201 SWIB
309 381
SWIB/MDM2 domain
Domain
Sequence
MSGRGAGGFPLPPLSPGGGAVAAALGAPPPPAGPGMLPGPALRGPGPAGGVGGPGAAAFR
PMGPAGPAAQYQRPGMSPGNRMPMAGLQVGPPAGSPFGAAAPLRPGMPPTMMDPFRKRLL
VPQAQPPMPAQRRGLKRRKMADKVLPQRIRELVPESQAYMDLLAFERKLDQTIARKRMEI
QEAIKKPLTQKRKLRIYISNTFSPSKAEGDSAGTAGTPGGTPAGDKVASWELRVEGKLLD
DPSKQKRKFSSFFKSLVIELDKELYGPDNHLVEWHRMPTTQETDGFQVKRPGDLNVKCTL
LLMLDHQPPQYKLDPRLARLLGVHTQTRAAIMQALWLYIKHNQLQDGHEREYINCNRYFR
QIFSCGRLRFSEIPMKLAGLL
QHPDPIVINHVISVDPNDQKKTACYDIDVEVDDPLKAQM
SNFLASTTNQQEIASLDVKIHETIESINQLKTQRDFMLSFSTDPQDFIQEWLRSQRRDLK
IITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRLT
Sequence length 531
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  ATP-dependent chromatin remodeling
Thermogenesis
Hepatocellular carcinoma
  RMTs methylate histone arginines
RUNX1 interacts with co-factors whose precise effect on RUNX1 targets is not known
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Brachydactyly Brachydactyly rs121908949, rs28937580, rs121909082, rs104894122, rs863223289, rs863223290, rs104894121, rs1587657302, rs863223292, rs74315386, rs74315387, rs28936397, rs753691079, rs121909348, rs121917852, rs121917853, rs121917854, rs121917855, rs121917859, rs121917861, rs267606873, rs267606872, rs267606985, rs267606986, rs267606987, rs267606988, rs28933082, rs397514519, rs869025613, rs869025614, rs886039878, rs1553540620, rs1057518333, rs1948841937, rs1948868228, rs1948842030, rs1948842142
Myelodysplasia Myelodysplasia rs141601766, rs1261178797
Myelodysplastic syndrome MYELODYSPLASTIC SYNDROME rs193303018, rs387906631, rs1576745225, rs373145711, rs752746786, rs377023736, rs373221034, rs1576749014, rs1600586587
Neutropenia Neutropenia rs879253882 28369036
Unknown
Disease name Disease term dbSNP ID References
Monocytic leukemia Leukemia, Monocytic, Chronic 28369036
Myeloid leukemia Myeloid Leukemia 28369036
Osteopenia Osteopenia
Otitis media Recurrent otitis media rs601338, rs1047781, rs1800028

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412