SLIT3 (slit guidance ligand 3)

Gene

• Entrez ID: 6586
• Gene name: Slit guidance ligand 3
• Gene symbol: SLIT3
• Synonyms: MEGF5, SLIL2, SLIT1, Slit-3, slit2
• Chromosome: 5
• Chromosome location: 5q34-q35.1
• Summary: The protein encoded by this gene is secreted, likely interacting with roundabout homolog receptors to effect cell migration. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2012]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT053057	hsa-miR-218-2-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	23720784
MIRT2109754	hsa-miR-362-5p	CLIP-seq
MIRT2109755	hsa-miR-500b	CLIP-seq
MIRT2109756	hsa-miR-501-5p	CLIP-seq
MIRT2333092	hsa-miR-3667-3p	CLIP-seq
MIRT2333093	hsa-miR-4724-3p	CLIP-seq
MIRT2333094	hsa-miR-4778-3p	CLIP-seq
MIRT2433308	hsa-miR-129-5p	CLIP-seq
MIRT2433309	hsa-miR-3168	CLIP-seq
MIRT2433310	hsa-miR-338-5p	CLIP-seq
MIRT2333094	hsa-miR-4778-3p	CLIP-seq
MIRT2433311	hsa-miR-548c-3p	CLIP-seq
MIRT2433312	hsa-miR-889	CLIP-seq
MIRT2459958	hsa-miR-1289	CLIP-seq
MIRT2459959	hsa-miR-3135b	CLIP-seq
MIRT2459960	hsa-miR-3198	CLIP-seq
MIRT2459961	hsa-miR-320e	CLIP-seq
MIRT2459962	hsa-miR-4294	CLIP-seq
MIRT2459963	hsa-miR-4309	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003180	Process	Aortic valve morphogenesis	ISS
GO:0003181	Process	Atrioventricular valve morphogenesis	ISS
GO:0005509	Function	Calcium ion binding	NAS	9813312
GO:0005615	Component	Extracellular space	IDA	19741192
GO:0005739	Component	Mitochondrion	NAS	11443047
GO:0007411	Process	Axon guidance	IBA	21873635
GO:0007411	Process	Axon guidance	IDA	11748139
GO:0008201	Function	Heparin binding	IBA	21873635
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0021834	Process	Chemorepulsion involved in embryonic olfactory bulb interneuron precursor migration	IDA	11748139
GO:0030308	Process	Negative regulation of cell growth	IMP	18829537
GO:0032870	Process	Cellular response to hormone stimulus	IEP	18566128
GO:0035385	Process	Roundabout signaling pathway	IMP	18829537
GO:0048495	Function	Roundabout binding	IBA	21873635
GO:0048495	Function	Roundabout binding	IPI	15207848
GO:0048846	Process	Axon extension involved in axon guidance	IDA	16840550
GO:0050919	Process	Negative chemotaxis	IBA	21873635
GO:0050919	Process	Negative chemotaxis	IDA	11748139
GO:0051414	Process	Response to cortisol	IEP	18566128
GO:0060412	Process	Ventricular septum morphogenesis	ISS
GO:0061364	Process	Apoptotic process involved in luteolysis	IEP	18566128
GO:0070100	Process	Negative regulation of chemokine-mediated signaling pathway	IMP	18829537

Other IDs

• MIM: 603745
• HGNC: 11087
• e!Ensembl: ENSG00000184347

Protein

• UniProt ID: O75094
• Protein name: Slit homolog 3 protein (Slit-3) (Multiple epidermal growth factor-like domains protein 5) (Multiple EGF-like domains protein 5)
• Protein function: May act as molecular guidance cue in cellular migration, and function may be mediated by interaction with roundabout homolog receptors.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01462	LRRNT	33 → 60	Leucine rich repeat N-terminal domain	Family
  PF13855	LRR_8	61 → 121	Leucine rich repeat	Repeat
  PF13855	LRR_8	109 → 169	Leucine rich repeat	Repeat
  PF13855	LRR_8	157 → 217	Leucine rich repeat	Repeat
  PF01463	LRRCT	239 → 264	Leucine rich repeat C-terminal domain	Family
  PF01462	LRRNT	279 → 306	Leucine rich repeat N-terminal domain	Family
  PF13855	LRR_8	307 → 367	Leucine rich repeat	Repeat
  PF13855	LRR_8	331 → 391	Leucine rich repeat	Repeat
  PF01463	LRRCT	461 → 486	Leucine rich repeat C-terminal domain	Family
  PF13855	LRR_8	532 → 593	Leucine rich repeat	Repeat
  PF13855	LRR_8	581 → 641	Leucine rich repeat	Repeat
  PF13855	LRR_8	605 → 665	Leucine rich repeat	Repeat
  PF01463	LRRCT	687 → 712	Leucine rich repeat C-terminal domain	Family
  PF01462	LRRNT	724 → 751	Leucine rich repeat N-terminal domain	Family
  PF13855	LRR_8	752 → 811	Leucine rich repeat	Repeat
  PF13855	LRR_8	799 → 859	Leucine rich repeat	Repeat
  PF01463	LRRCT	881 → 906	Leucine rich repeat C-terminal domain	Family
  PF12661	hEGF	925 → 944	Human growth factor-like EGF	Domain
  PF00008	EGF	959 → 992	EGF-like domain	Domain
  PF00008	EGF	1000 → 1030	EGF-like domain	Domain
  PF00008	EGF	1038 → 1070	EGF-like domain	Domain
  PF00008	EGF	1078 → 1108	EGF-like domain	Domain
  PF00008	EGF	1123 → 1153	EGF-like domain	Domain
  PF02210	Laminin_G_2	1186 → 1314	Laminin G domain	Domain
  PF00008	EGF	1371 → 1401	EGF-like domain	Domain

• Sequence:

  MAPGWAGVGAAVRARLALALALASVLSGPPAVACPTKCTCSAASVDCHGLGLRAVPRGIP
  RNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNK
  LQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRAL
  RDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTVGQFT
  LCMAPVHLRGFNVADVQKKEYVCPAPHSEPPSCNANSISCPSPCTCSNNIVDCRGKGLME
  IPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSL
  VLYGNKITEIVKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISK
  GLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKS
  KKFRCSGSEDYRSRFSSECFMDLVCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLN
  DNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRV
  FRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINL
  LSNPFNCNCHLAWLGKWLRKRRIVSGNPRCQKPFFLKEIPIQDVAIQDFTCDGNEESSCQ
  LSPRCPEQCTCMETVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAVPRELSALRHLTLI
  DLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPE
  GSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPEPMADRLLLTTPT
  HRFQCKGPVDINIVAKCNACLSSPCKNNGTCTQDPVELYRCACPYSYKGKDCTVPINTCI
  QNPCQHGGTCHLSDSHKDGFSCSCPLGFEGQRCEINPDDCEDNDCENNATCVDGINNYVC
  ICPPNYTGELCDEVIDHCVPELNLCQHEAKCIPLDKGFSCECVPGYSGKLCETDNDDCVA
  HKCRHGAQCVDTINGYTCTCPQGFSGPFCEHPPPMVLLQTSPCDQYECQNGAQCIVVQQE
  PTCRCPPGFAGPRCEKLITVNFVGKDSYVELASAKVRPQANISLQVATDKDNGILLYKGD
  NDPLALELYQGHVRLVYDSLSSPPTTVYSVETVNDGQFHSVELVTLNQTLNLVVDKGTPK
  SLGKLQKQPAVGINSPLYLGGIPTSTGLSALRQGTDRPLGGFHGCIHEVRINNELQDFKA
  LPPQSLGVSPGCKSCTVCKHGLCRSVEKDSVVCECRPGWTGPLCDQEARDPCLGHRCHHG
  KCVATGTSYMCKCAEGYGGDLCDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSG
  EHCQQENPCLGQVVREVIRRQKGYASCATASKVPIMECRGGCGPQCCQPTRSKRRKYVFQ
  CTDGSSFVEEVERHLECGCLACS

• Sequence length: 1523

Pathways

KEGG:

Axon guidance

Reactome:

Signaling by ROBO receptors

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Atrial fibrillation	Atrial Fibrillation	rs120074192, rs121908590, rs121908593, rs121434558, rs587776851, rs387906612, rs387906613, rs387906614, rs387906615, rs199472687, rs199472705, rs199473324, rs587777336, rs587777339, rs587777557, rs587777558, rs587777559, rs587777560, rs886037778, rs769405762, rs770372675	30061737, 29892015
Psoriasis	Psoriasis	rs281875215, rs587777763, rs281875213, rs281875212	25574825
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	15231749

Unknown
Disease name	Disease term	dbSNP ID	References
Mental depression	Unipolar Depression, Major Depressive Disorder	rs587778876, rs587778877	21152026
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	rs199865688, rs397515994, rs757096307	29892015, 30061737