SLC22A2 (solute carrier family 22 member 2)

Gene

• Entrez ID: 6582
• Gene name: Solute carrier family 22 member 2
• Gene symbol: SLC22A2
• Synonyms: Oct-02
• Chromosome: 6
• Chromosome location: 6q25.3
• Summary: Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar c

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017635	hsa-miR-335-5p	Microarray	18185580
MIRT1354399	hsa-miR-3152-3p	CLIP-seq
MIRT1354400	hsa-miR-4724-5p	CLIP-seq
MIRT1354401	hsa-miR-4766-5p	CLIP-seq
MIRT1354402	hsa-miR-488	CLIP-seq
MIRT1354399	hsa-miR-3152-3p	CLIP-seq
MIRT2104826	hsa-miR-3622a-3p	CLIP-seq
MIRT2104827	hsa-miR-3622b-3p	CLIP-seq
MIRT2104828	hsa-miR-412	CLIP-seq
MIRT2104829	hsa-miR-4282	CLIP-seq
MIRT2104830	hsa-miR-4659a-3p	CLIP-seq
MIRT2104831	hsa-miR-4659b-3p	CLIP-seq
MIRT1354400	hsa-miR-4724-5p	CLIP-seq
MIRT2104832	hsa-miR-513a-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
USF1	Activation	17314196
USF1	Unknown	18508876

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005275	Function	Amine transmembrane transporter activity	IDA	9687576
GO:0005326	Function	Neurotransmitter transmembrane transporter activity	IDA	9687576
GO:0005886	Component	Plasma membrane	IDA	23137377
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	9260930
GO:0006836	Process	Neurotransmitter transport	IDA	9687576
GO:0006855	Process	Drug transmembrane transport	TAS
GO:0006919	Process	Activation of cysteine-type endopeptidase activity involved in apoptotic process	ISS
GO:0007269	Process	Neurotransmitter secretion	TAS
GO:0007589	Process	Body fluid secretion	TAS	9260930
GO:0008504	Function	Monoamine transmembrane transporter activity	IDA	9687576
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0015101	Function	Organic cation transmembrane transporter activity	IBA	21873635
GO:0015101	Function	Organic cation transmembrane transporter activity	IDA	9687576, 16024787, 22806583, 24291757
GO:0015101	Function	Organic cation transmembrane transporter activity	IMP	23864433
GO:0015179	Function	L-amino acid transmembrane transporter activity	IMP	23864433
GO:0015214	Function	Pyrimidine nucleoside transmembrane transporter activity	IMP	20477935
GO:0015220	Function	Choline transmembrane transporter activity	IDA	9687576
GO:0015562	Function	Efflux transmembrane transporter activity	IDA	9687576
GO:0015695	Process	Organic cation transport	IBA	21873635
GO:0015695	Process	Organic cation transport	IDA	9687576, 16024787, 22806583, 24291757
GO:0015695	Process	Organic cation transport	IMP	23864433
GO:0015837	Process	Amine transport	IDA	9687576
GO:0015871	Process	Choline transport	IDA	9687576
GO:0016020	Component	Membrane	TAS	9260930
GO:0016324	Component	Apical plasma membrane	IDA	20477935
GO:0019534	Function	Toxin transmembrane transporter activity	IDA	9687576, 22806583, 24291757
GO:0019534	Function	Toxin transmembrane transporter activity	IMP	20477935
GO:0042136	Process	Neurotransmitter biosynthetic process	TAS
GO:0042908	Process	Xenobiotic transport	IDA	9687576, 22806583, 24291757
GO:0042908	Process	Xenobiotic transport	IMP	20477935
GO:0042910	Function	Xenobiotic transmembrane transporter activity	IMP	20477935
GO:0051610	Process	Serotonin uptake	IDA	9687576
GO:0051615	Process	Histamine uptake	IDA	9687576
GO:0051620	Process	Norepinephrine uptake	IDA	9687576
GO:0061459	Function	L-arginine transmembrane transporter activity	IMP	23864433
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0072531	Process	Pyrimidine-containing compound transmembrane transport	IEA
GO:0089718	Process	Amino acid import across plasma membrane	IMP	23864433
GO:0090494	Process	Dopamine uptake	IDA	9687576
GO:0097638	Process	L-arginine import across plasma membrane	IMP	23864433
GO:0098793	Component	Presynapse	IEA
GO:0140115	Process	Export across plasma membrane	IDA	9687576
GO:0150104	Process	Transport across blood-brain barrier	NAS	26590417, 30280653
GO:1901998	Process	Toxin transport	IDA	9687576, 22806583, 24291757
GO:1901998	Process	Toxin transport	IMP	20477935
GO:1902475	Process	L-alpha-amino acid transmembrane transport	IMP	23864433
GO:1990962	Process	Xenobiotic transport across blood-brain barrier	NAS	20477935

Other IDs

• MIM: 602608
• HGNC: 10966
• e!Ensembl: ENSG00000112499

Protein

• UniProt ID: O15244
• Protein name: Solute carrier family 22 member 2 (Organic cation transporter 2) (hOCT2)
• Protein function: Electrogenic voltage-dependent transporter that mediates the transport of a variety of organic cations such as endogenous bioactive amines, cationic drugs and xenobiotics (PubMed:9260930, PubMed:9687576). Functions as a Na(+)-independent, bidire
• PDB: 8ET9
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00083	Sugar_tr	91 → 529	Sugar (and other) transporter	Family

• Sequence:

  MPTTVDDVLEHGGEFHFFQKQMFFLLALLSATFAPIYVGIVFLGFTPDHRCRSPGVAELS
  LRCGWSPAEELNYTVPGPGPAGEASPRQCRRYEVDWNQSTFDCVDPLASLDTNRSRLPLG
  PCRDGWVYETPGSSIVTEFNLVCANSWMLDLFQSSVNVGFFIGSMSIGYIADRFGRKLCL
  LTTVLINAAAGVLMAISPTYTWMLIFRLIQGLVSKAGWLIGYILITEFVGRRYRRTVGIF
  YQVAYTVGLLVLAGVAYALPHWRWLQFTVSLPNFFFLLYYWCIPESPRWLISQNKNAEAM
  RIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIRKHTMILMYNWFTSSV
  LYQGLIMHMGLAGDNIYLDFFYSALVEFPAAFMIILTIDRIGRRYPWAASNMVAGAACLA
  SVFIPGDLQWLKIIISCLGRMGITMAYEIVCLVNAELYPTFIRNLGVHICSSMCDIGGII
  TPFLVYRLTNIWLELPLMVFGVLGLVAGGLVLLLPETKGKALPETIEEAENMQRPRKNKE
  KMIYLQVQKLDIPLN

• Sequence length: 555

Pathways

KEGG:

Choline metabolism in cancer

Reactome:

Neurotransmitter clearance
Norepinephrine Neurotransmitter Release Cycle
Abacavir transmembrane transport
Na+/Cl- dependent neurotransmitter transporters
Organic cation transport

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Diabetes	Diabetes	rs80356611	31451708
Diabetes mellitus	Diabetes Mellitus	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs4402960, rs1362648752, rs3745368, rs3792267, rs3842570, rs5030952, rs2975760, rs119489103, rs7903146, rs12255372, rs11196205, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237, rs80356613, rs137852740, rs137852786, rs387906407, rs151344623, rs28938469, rs28936371, rs137852672, rs80356637, rs80356642, rs80356653, rs137852673, rs137852674, rs80356634, rs80356651, rs193929360, rs137853334, rs137853335, rs137853336, rs1600731198, rs137853338, rs121964882, rs121964883, rs387906511, rs121964884, rs121964885, rs2147483647, rs387906512, rs121964887, rs121964888, rs121964889, rs121964890, rs121964891, rs28934878, rs74315383, rs121964893, rs886037620, rs886037621, rs80356663, rs121434593, rs121913150, rs587776825, rs137853236, rs2135842335, rs137853237, rs137853238, rs2135818776, rs1566092470, rs1463923467, rs137853243, rs137853244, rs2135839114, rs137853245, rs2135847417, rs121918407, rs104894005, rs104894006, rs80356655, rs104894008, rs104894009, rs104894010, rs104894011, rs80356654, rs104894016, rs193929376, rs193929374, rs193929375, rs193929373, rs80356666, rs80356669, rs80356664, rs193929366, rs1048095, rs193929355, rs193929356, rs1259467443, rs104893642, rs387906777, rs387906779, rs141804752, rs182349376, rs184917682, rs193922396, rs193922400, rs193922401, rs137852676, rs193922407, rs193922638, rs193922257, rs193922258, rs193922259, rs193922260, rs193922261, rs193922262, rs193922263, rs193922264, rs193922265, rs193922268, rs193921338, rs193922269, rs193922272, rs193922273, rs193922275, rs193922278, rs193922279, rs193922280, rs193922281, rs193922282, rs193922283, rs193922284, rs193922286, rs193922287, rs193922289, rs193922291, rs193922295, rs193922297, rs193922300, rs193922302, rs193922303, rs193922308, rs193922313, rs193922314, rs144723656, rs193922315, rs193922316, rs193922317, rs148311934, rs193922319, rs193922320, rs193922326, rs193922329, rs193922330, rs193922331, rs193922335, rs193922336, rs193922338, rs193922340, rs193922341, rs193922471, rs193922475, rs193922476, rs193922479, rs193922355, rs193922356, rs193922576, rs193922578, rs193922582, rs193922588, rs193922592, rs193922594, rs193922596, rs386134267, rs193922598, rs193922599, rs193922600, rs193922604, rs193922605, rs397514580, rs397515519, rs267601516, rs587780343, rs587780345, rs587780346, rs587780347, rs587780357, rs148954387, rs61736969, rs587783673, rs587783672, rs587783669, rs786204676, rs794727236, rs151344624, rs794727775, rs794727839, rs199946797, rs869320673, rs796065047, rs759072800, rs797045595, rs797045209, rs797045207, rs797045213, rs797045623, rs863225280, rs149703259, rs864321656, rs139964066, rs777870079, rs878853246, rs769268803, rs886039380, rs886041392, rs886041391, rs886042610, rs143064649, rs1057516192, rs746480424, rs1057516281, rs576684889, rs754728827, rs1057520291, rs1057520779, rs893256143, rs1057520504, rs1057524790, rs1057524902, rs1057524904, rs1057524905, rs764232985, rs1064793998, rs1064794268, rs769086289, rs369429452, rs1085307913, rs1131691416, rs765432081, rs1131692182, rs748749585, rs1554335441, rs762263694, rs1312678560, rs767565869, rs1375656631, rs1554335391, rs1360415315, rs1554335616, rs1554335752, rs1554909277, rs769518471, rs757171524, rs768951263, rs762703502, rs1555212248, rs1555212359, rs1555813319, rs1555816654, rs1553638903, rs1553638909, rs948820149, rs371977235, rs1553784995, rs76474829, rs200998587, rs1415041911, rs1554334894, rs1260178539, rs1554335421, rs1555211904, rs779184183, rs1554335564, rs200670692, rs1400535021, rs1554334872, rs1555212749, rs1553876668, rs1553878211, rs954727530, rs1554924035, rs372307320, rs925231098, rs1554913069, rs1554933565, rs766431403, rs746714109, rs751279984, rs770664202, rs1008906426, rs758844607, rs1554924540, rs1566092307, rs753998395, rs1565885935, rs1167124132, rs1376796469, rs556436603, rs1562715657, rs1486280029, rs1564869850, rs755259997, rs769569410, rs1172328722, rs1286294151, rs1375557127, rs1568731279, rs1562715426, rs556581174, rs1564865302, rs1565886545, rs776793516, rs1568724014, rs1392795567, rs781260712, rs1562719705, rs1382448285, rs1564977373, rs750586210, rs1598842892, rs1583592247, rs780612692, rs1593060859, rs1476637197, rs751279776, rs1593060890, rs1191912908, rs1167675604, rs1583601110, rs1593058932, rs778611627, rs753296261	31451708
Kidney disease	Kidney Diseases, Chronic Kidney Diseases	rs74315342, rs749740335, rs757649673, rs112417755, rs35138315	22525860, 21931561, 20383146, 22479191
Obesity	Obesity	rs34911341, rs74315349, rs1474810899, rs2282440, rs2491132, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562, rs121913564, rs74315393, rs121913556, rs2989924, rs193922650, rs193922685, rs193922687, rs751160202, rs1421085, rs747681609, rs1553400259, rs13447339, rs370479598, rs1554394014, rs1553174844, rs756232889, rs369841551, rs1557670950, rs1571321748, rs148538980, rs1572820988, rs1591461970, rs1419374563, rs745921568, rs144159890, rs1570714352, rs779783209, rs1573250294, rs1573254045, rs1580744791, rs1580746829, rs6548238, rs7138803, rs7754840	27401566

Unknown
Disease name	Disease term	dbSNP ID	References
Kidney failure	Kidney Failure, Chronic		31152163, 20383146