SLC17A1 (solute carrier family 17 member 1)

Gene

• Entrez ID: 6568
• Gene name: Solute carrier family 17 member 1
• Gene symbol: SLC17A1
• Synonyms: NAPI-1, NPT-1, NPT1
• Chromosome: 6
• Chromosome location: 6p22.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019052	hsa-miR-335-5p	Microarray	18185580
MIRT1353386	hsa-miR-1915	CLIP-seq
MIRT1353387	hsa-miR-2276	CLIP-seq
MIRT1353388	hsa-miR-302a	CLIP-seq
MIRT1353389	hsa-miR-302b	CLIP-seq
MIRT1353390	hsa-miR-302c	CLIP-seq
MIRT1353391	hsa-miR-302d	CLIP-seq
MIRT1353392	hsa-miR-302e	CLIP-seq
MIRT1353393	hsa-miR-3155	CLIP-seq
MIRT1353394	hsa-miR-3155b	CLIP-seq
MIRT1353395	hsa-miR-3194-3p	CLIP-seq
MIRT1353396	hsa-miR-372	CLIP-seq
MIRT1353397	hsa-miR-373	CLIP-seq
MIRT1353398	hsa-miR-3942-3p	CLIP-seq
MIRT1353399	hsa-miR-4666-5p	CLIP-seq
MIRT1353400	hsa-miR-4726-3p	CLIP-seq
MIRT1353401	hsa-miR-4772-3p	CLIP-seq
MIRT1353402	hsa-miR-484	CLIP-seq
MIRT1353403	hsa-miR-520a-3p	CLIP-seq
MIRT1353404	hsa-miR-520b	CLIP-seq
MIRT1353405	hsa-miR-520c-3p	CLIP-seq
MIRT1353406	hsa-miR-520d-3p	CLIP-seq
MIRT1353407	hsa-miR-520e	CLIP-seq
MIRT1353408	hsa-miR-656	CLIP-seq
MIRT1353409	hsa-miR-760	CLIP-seq
MIRT2459500	hsa-miR-138	CLIP-seq
MIRT2459501	hsa-miR-3607-5p	CLIP-seq
MIRT2459502	hsa-miR-4281	CLIP-seq
MIRT2459500	hsa-miR-138	CLIP-seq
MIRT2459501	hsa-miR-3607-5p	CLIP-seq
MIRT2459502	hsa-miR-4281	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005436	Function	Sodium:phosphate symporter activity	TAS	8867793
GO:0005764	Component	Lysosome	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0006811	Process	Ion transport	TAS
GO:0006817	Process	Phosphate ion transport	TAS	8867793
GO:0006820	Process	Anion transport	IBA	21873635
GO:0015114	Function	Phosphate ion transmembrane transporter activity	IEA
GO:0015136	Function	Sialic acid transmembrane transporter activity	IBA	21873635
GO:0015739	Process	Sialic acid transport	IBA	21873635
GO:0015747	Process	Urate transport	IMP	27906618
GO:0016020	Component	Membrane	TAS	8288239
GO:0016021	Component	Integral component of membrane	IBA	21873635
GO:0016324	Component	Apical plasma membrane	IDA	27906618
GO:0022857	Function	Transmembrane transporter activity	IBA	21873635
GO:0035435	Process	Phosphate ion transmembrane transport	IEA
GO:0035725	Process	Sodium ion transmembrane transport	IEA
GO:0046415	Process	Urate metabolic process	IMP	19503597

Other IDs

• MIM: 182308
• HGNC: 10929
• e!Ensembl: ENSG00000124568

Protein

• UniProt ID: Q14916
• Protein name: Sodium-dependent phosphate transport protein 1 (Na(+)/PI cotransporter 1) (Na/Pi-4) (Renal Na(+)-dependent phosphate cotransporter 1) (Renal sodium-dependent phosphate transport protein 1) (Renal sodium-phosphate transport protein 1) (Sodium/phosphate cot
• Protein function: Important for the resorption of phosphate by the kidney (PubMed:7826357). May be involved in actively transporting phosphate into cells via Na(+) cotransport in the renal brush border membrane (PubMed:7826357). Plays a role in urate transport in
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07690	MFS_1	26 → 410	Major Facilitator Superfamily	Family

• Sequence:

  MQMDNRLPPKKVPGFCSFRYGLSFLVHCCNVIITAQRACLNLTMVVMVNSTDPHGLPNTS
  TKKLLDNIKNPMYNWSPDIQGIILSSTSYGVIIIQVPVGYFSGIYSTKKMIGFALCLSSV
  LSLLIPPAAGIGVAWVVVCRAVQGAAQGIVATAQFEIYVKWAPPLERGRLTSMSTSGFLL
  GPFIVLLVTGVICESLGWPMVFYIFGACGCAVCLLWFVLFYDDPKDHPCISISEKEYITS
  SLVQQVSSSRQSLPIKAILKSLPVWAISTGSFTFFWSHNIMTLYTPMFINSMLHVNIKEN
  GFLSSLPYLFAWICGNLAGQLSDFFLTRNILSVIAVRKLFTAAGFLLPAIFGVCLPYLSS
  TFYSIVIFLILAGATGSFCLGGVFINGLDIAPRYFGFIKACSTLTGMIGGLIASTLTGLI
  LKQDPESAWFKTFILMAAINVTGLIFYLIVATAEIQDWAKEKQHTRL

• Sequence length: 467

Pathways

Reactome:

Organic anion transporters

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	19571809

Unknown
Disease name	Disease term	dbSNP ID	References
Gout	Gout		20884846, 21768215, 27899376, 31578528, 23263486
Gouty arthritis	Arthritis, Gouty		23263486, 27899376, 31578528, 20884846, 21768215