GeDiPNet: Comprehensive Gene Data - OMIM, HGNC, Ensembl, UniProt, GO, Transcription Factors & miRNA

Home
Browse
- Genes
- Diseases
- Pathways
  - Reactome
  - KEGG
Analysis
Help
Links
FAQ
Contact us

SKP2 (S-phase kinase associated protein 2)

Gene

6502

S-phase kinase associated protein 2

SKP2

FBL1, FBXL1, FLB1, p45

5p13.2

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), w

Show/Hide all(37)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021626	hsa-miR-142-3p	Microarray	17612493
MIRT030943	hsa-miR-21-5p	Microarray	18591254
MIRT053122	hsa-miR-7-5p	GFP reporter assay	23762407
MIRT561051	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT561050	hsa-miR-6882-5p	PAR-CLIP	20371350
MIRT358762	hsa-miR-3163	PAR-CLIP	20371350
MIRT561049	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT408388	hsa-miR-5701	PAR-CLIP	20371350
MIRT561049	hsa-miR-340-5p	qRT-PCR, Luciferase reporter assay, Western blot	25151966
MIRT358762	hsa-miR-3163	Luciferase reporter assay	26482610
MIRT561051	hsa-miR-548c-3p	PAR-CLIP	27292025
MIRT561051	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT561050	hsa-miR-6882-5p	PAR-CLIP	20371350
MIRT358762	hsa-miR-3163	PAR-CLIP	20371350
MIRT561049	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT408388	hsa-miR-5701	PAR-CLIP	20371350
MIRT1351300	hsa-miR-105	CLIP-seq
MIRT1351301	hsa-miR-298	CLIP-seq
MIRT1351302	hsa-miR-3678-3p	CLIP-seq
MIRT1351303	hsa-miR-4493	CLIP-seq
MIRT1351304	hsa-miR-4668-5p	CLIP-seq
MIRT1351305	hsa-miR-548a-3p	CLIP-seq
MIRT1351306	hsa-miR-548aa	CLIP-seq
MIRT1351307	hsa-miR-548e	CLIP-seq
MIRT1351308	hsa-miR-548f	CLIP-seq
MIRT2104099	hsa-miR-1587	CLIP-seq
MIRT2104100	hsa-miR-3145-5p	CLIP-seq
MIRT2104101	hsa-miR-338-3p	CLIP-seq
MIRT2104102	hsa-miR-4530	CLIP-seq
MIRT2104103	hsa-miR-4661-5p	CLIP-seq
MIRT2104104	hsa-miR-4674	CLIP-seq
MIRT2104105	hsa-miR-508-5p	CLIP-seq
MIRT2104106	hsa-miR-516a-3p	CLIP-seq
MIRT1351305	hsa-miR-548a-3p	CLIP-seq
MIRT1351307	hsa-miR-548e	CLIP-seq
MIRT1351308	hsa-miR-548f	CLIP-seq
MIRT2104107	hsa-miR-766	CLIP-seq

Transcription factors

Show/Hide all(11)

Transcription factor	Regulation	Reference
E2F1	Activation	23352642
E2F1	Unknown	17483325;20424123;23348237;24574749
ELK1	Unknown	16969077
ING4	Repression	18399550
LEF1	Unknown	19174556
MYCN	Repression	17495526
SP1	Activation	19329185
SP1	Unknown	16969077
TCF4	Unknown	19174556
VDR	Repression	16883603
YBX1	Repression	20596676

Show/Hide all(24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	TAS	7553852
GO:0000086	Process	G2/M transition of mitotic cell cycle	IBA	21873635
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0005515	Function	Protein binding	IPI	11931757, 12504026, 12609982, 12813041, 16209941, 16286470, 16376880, 16880511, 17157259, 18239684, 18805092, 18818696, 21145461, 21856198, 22632967, 22770219, 23911321, 25241761, 27194766, 27542266, 27705803, 28514442, 29997244, 30833792
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0016032	Process	Viral process	IEA
GO:0016579	Process	Protein deubiquitination	TAS
GO:0019005	Component	SCF ubiquitin ligase complex	IBA	21873635
GO:0019005	Component	SCF ubiquitin ligase complex	IDA	16880511
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IBA	21873635
GO:0042802	Function	Identical protein binding	IPI	22770219
GO:0042981	Process	Regulation of apoptotic process	IDA	23277542
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	27194766
GO:0043687	Process	Post-translational protein modification	TAS
GO:0045087	Process	Innate immune response	IMP	27194766
GO:0051607	Process	Defense response to virus	IMP	27194766
GO:0051726	Process	Regulation of cell cycle	IBA	21873635
GO:0070936	Process	Protein K48-linked ubiquitination	IMP	27194766

MIM	HGNC	e!Ensembl
601436	10901	ENSG00000145604

Protein

UniProt ID

Q13309

Protein name

S-phase kinase-associated protein 2 (Cyclin-A/CDK2-associated protein p45) (F-box protein Skp2) (F-box/LRR-repeat protein 1) (p45skp2)

Protein function

Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transdu

PDB

1FQV , 1FS1 , 1FS2 , 1LDK , 2ASS , 2AST , 7B5L , 7B5M , 7B5R , 7LUO , 7Z8T , 7Z8V , 7ZBW , 7ZBZ , 8BYA , 8BYL , 8CDJ , 8CDK , 8OR0 , 8OR3 , 8OR4

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12937	F-box-like	97 → 143	F-box-like	Domain

Sequence

MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLG
HPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKV
SGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSP
FRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGC
SGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKS
DLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIP
TLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQK
PSCL

Sequence length

424

Interactions

View interactions

	KEGG		Reactome
	FoxO signaling pathway Cell cycle Ubiquitin mediated proteolysis mTOR signaling pathway Epstein-Barr virus infection Pathways in cancer Viral carcinogenesis Small cell lung cancer		APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1 SCF(Skp2)-mediated degradation of p27/p21 Ub-specific processing proteases Orc1 removal from chromatin Cyclin D associated events in G1 Regulation of RUNX2 expression and activity Neddylation Antigen processing: Ubiquitination & Proteasome degradation

Associated diseases

Show/Hide Causal Diseases (3)

Causal
Disease name	Disease term	dbSNP ID	References
Diffuse lymphoma	Diffuse Large B-Cell Lymphoma	rs121912651, rs121913289, rs121913293, rs878854402, rs869025340, rs1349928568, rs1569115687, rs121913291	18850583
Medulloblastoma	Medulloblastoma, Childhood Medulloblastoma, Adult Medulloblastoma, Desmoplastic Medulloblastoma, Melanotic medulloblastoma	rs1589970134, rs587776578, rs587776579, rs17847577, rs111033171, rs80359604, rs80358785, rs80358814, rs863224925, rs1555950011, rs1554231278, rs926177767, rs759412460, rs1564032829, rs761911009	19270706
Ovarian cancer	Malignant neoplasm of ovary	rs34424986, rs137853060, rs28934575, rs79658334, rs121913021, rs62625308, rs80356898, rs80357579, rs41293497, rs80356904, rs80357471, rs80357522, rs80357234, rs80357912, rs80357828, rs80357208, rs55770810, rs80358165, rs80358010, rs587780226, rs536907995, rs139414606, rs371638537, rs574552037, rs730881647, rs747993448, rs786202125, rs786202962, rs121913321, rs189261858, rs869320800, rs753023295, rs779466229, rs752411477, rs80357438, rs191486604, rs760874290, rs752780954, rs760782298, rs1555591361, rs1555578360, rs1555588460, rs1555587401, rs747427602, rs112675807, rs80357393	19636294

Show/Hide Unknown Diseases (6)

Unknown
Disease name	Disease term	dbSNP ID	References
Benign neoplasm	Benign Neoplasm		18451165
Liver carcinoma	Liver carcinoma		12717389
Malignant neoplasm	Malignant Neoplasms		18451165
Medullomyoblastoma	Medullomyoblastoma		19270706
Neoplasms	Neoplasms		18451165
Ovarian neoplasm	ovarian neoplasm		19636294

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412