SLC26A6 (solute carrier family 26 member 6)

Gene

• Entrez ID: 65010
• Gene name: Solute carrier family 26 member 6
• Gene symbol: SLC26A6
• Synonyms: -
• Chromosome: 3
• Chromosome location: 3p21.31
• Summary: This gene belongs to the solute carrier 26 family, whose members encode anion transporter proteins. This particular family member encodes a protein involved in transporting chloride, oxalate, sulfate and bicarbonate. Alternatively spliced transcript varia

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT733880	hsa-miR-411-3p	Immunohistochemistry (IHC), Luciferase reporter assay, Western blotting	33772775
MIRT733880	hsa-miR-411-3p	Immunohistochemistry (IHC), Luciferase reporter assay, Western blotting	33772775
MIRT733880	hsa-miR-411-3p	Luciferase reporter assay, Western blotting, qRT-PCR	33772775
MIRT1357905	hsa-miR-1202	CLIP-seq
MIRT1357906	hsa-miR-1291	CLIP-seq
MIRT1357907	hsa-miR-146b-3p	CLIP-seq
MIRT1357908	hsa-miR-217	CLIP-seq
MIRT1357909	hsa-miR-3194-5p	CLIP-seq
MIRT1357910	hsa-miR-339-5p	CLIP-seq
MIRT1357911	hsa-miR-3972	CLIP-seq
MIRT1357912	hsa-miR-4293	CLIP-seq
MIRT1357913	hsa-miR-125a-5p	CLIP-seq
MIRT1357914	hsa-miR-125b	CLIP-seq
MIRT1357915	hsa-miR-1289	CLIP-seq
MIRT1357916	hsa-miR-147	CLIP-seq
MIRT1357917	hsa-miR-1915	CLIP-seq
MIRT1357918	hsa-miR-219-1-3p	CLIP-seq
MIRT1357919	hsa-miR-3177-5p	CLIP-seq
MIRT1357920	hsa-miR-3198	CLIP-seq
MIRT1357921	hsa-miR-3667-3p	CLIP-seq
MIRT1357922	hsa-miR-4294	CLIP-seq
MIRT1357923	hsa-miR-4309	CLIP-seq
MIRT1357924	hsa-miR-4319	CLIP-seq
MIRT1357925	hsa-miR-432	CLIP-seq
MIRT1357926	hsa-miR-4682	CLIP-seq
MIRT1357927	hsa-miR-4726-3p	CLIP-seq
MIRT1357928	hsa-miR-4732-3p	CLIP-seq
MIRT1357929	hsa-miR-571	CLIP-seq
MIRT1357930	hsa-miR-670	CLIP-seq
MIRT1357931	hsa-miR-890	CLIP-seq
MIRT1357907	hsa-miR-146b-3p	CLIP-seq
MIRT2330359	hsa-miR-3130-3p	CLIP-seq
MIRT2330360	hsa-miR-3173-5p	CLIP-seq
MIRT2330361	hsa-miR-4257	CLIP-seq
MIRT2330362	hsa-miR-520a-5p	CLIP-seq
MIRT2330363	hsa-miR-525-5p	CLIP-seq
MIRT2330364	hsa-miR-874	CLIP-seq
MIRT2440444	hsa-miR-1343	CLIP-seq
MIRT1357907	hsa-miR-146b-3p	CLIP-seq
MIRT1357916	hsa-miR-147	CLIP-seq
MIRT1357918	hsa-miR-219-1-3p	CLIP-seq
MIRT2440445	hsa-miR-29a	CLIP-seq
MIRT2440446	hsa-miR-29b	CLIP-seq
MIRT2440447	hsa-miR-29c	CLIP-seq
MIRT2440448	hsa-miR-3132	CLIP-seq
MIRT2440449	hsa-miR-3135	CLIP-seq
MIRT1357919	hsa-miR-3177-5p	CLIP-seq
MIRT2440450	hsa-miR-3612	CLIP-seq
MIRT2440451	hsa-miR-4254	CLIP-seq
MIRT2440452	hsa-miR-4443	CLIP-seq
MIRT2440453	hsa-miR-4652-5p	CLIP-seq
MIRT1357926	hsa-miR-4682	CLIP-seq
MIRT2440454	hsa-miR-4802-3p	CLIP-seq
MIRT2440455	hsa-miR-4802-5p	CLIP-seq
MIRT1357929	hsa-miR-571	CLIP-seq
MIRT2440456	hsa-miR-619	CLIP-seq
MIRT2440457	hsa-miR-650	CLIP-seq
MIRT1357905	hsa-miR-1202	CLIP-seq
MIRT1357906	hsa-miR-1291	CLIP-seq
MIRT1357907	hsa-miR-146b-3p	CLIP-seq
MIRT1357908	hsa-miR-217	CLIP-seq
MIRT1357909	hsa-miR-3194-5p	CLIP-seq
MIRT1357910	hsa-miR-339-5p	CLIP-seq
MIRT2624448	hsa-miR-3661	CLIP-seq
MIRT1357911	hsa-miR-3972	CLIP-seq
MIRT2440451	hsa-miR-4254	CLIP-seq
MIRT1357912	hsa-miR-4293	CLIP-seq
MIRT2440456	hsa-miR-619	CLIP-seq
MIRT2624449	hsa-miR-631	CLIP-seq
MIRT1357905	hsa-miR-1202	CLIP-seq
MIRT1357913	hsa-miR-125a-5p	CLIP-seq
MIRT1357914	hsa-miR-125b	CLIP-seq
MIRT1357915	hsa-miR-1289	CLIP-seq
MIRT1357906	hsa-miR-1291	CLIP-seq
MIRT1357907	hsa-miR-146b-3p	CLIP-seq
MIRT1357916	hsa-miR-147	CLIP-seq
MIRT1357917	hsa-miR-1915	CLIP-seq
MIRT1357908	hsa-miR-217	CLIP-seq
MIRT1357918	hsa-miR-219-1-3p	CLIP-seq
MIRT1357919	hsa-miR-3177-5p	CLIP-seq
MIRT1357909	hsa-miR-3194-5p	CLIP-seq
MIRT1357920	hsa-miR-3198	CLIP-seq
MIRT1357910	hsa-miR-339-5p	CLIP-seq
MIRT2624448	hsa-miR-3661	CLIP-seq
MIRT1357921	hsa-miR-3667-3p	CLIP-seq
MIRT1357911	hsa-miR-3972	CLIP-seq
MIRT2440451	hsa-miR-4254	CLIP-seq
MIRT1357912	hsa-miR-4293	CLIP-seq
MIRT1357922	hsa-miR-4294	CLIP-seq
MIRT1357923	hsa-miR-4309	CLIP-seq
MIRT1357924	hsa-miR-4319	CLIP-seq
MIRT1357925	hsa-miR-432	CLIP-seq
MIRT2691032	hsa-miR-4539	CLIP-seq
MIRT2440453	hsa-miR-4652-5p	CLIP-seq
MIRT1357926	hsa-miR-4682	CLIP-seq
MIRT1357927	hsa-miR-4726-3p	CLIP-seq
MIRT1357928	hsa-miR-4732-3p	CLIP-seq
MIRT2440454	hsa-miR-4802-3p	CLIP-seq
MIRT2440455	hsa-miR-4802-5p	CLIP-seq
MIRT1357929	hsa-miR-571	CLIP-seq
MIRT2440456	hsa-miR-619	CLIP-seq
MIRT2624449	hsa-miR-631	CLIP-seq
MIRT1357930	hsa-miR-670	CLIP-seq
MIRT1357931	hsa-miR-890	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005254	Function	Chloride channel activity	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0006811	Process	Ion transport	TAS
GO:0006821	Process	Chloride transport	IMP	20501439
GO:0008271	Function	Secondary active sulfate transmembrane transporter activity	IEA
GO:0008272	Process	Sulfate transport	IMP	20501439
GO:0008272	Process	Sulfate transport	ISS
GO:0012506	Component	Vesicle membrane	ISS
GO:0015106	Function	Bicarbonate transmembrane transporter activity	IBA	21873635
GO:0015106	Function	Bicarbonate transmembrane transporter activity	IMP	20501439
GO:0015106	Function	Bicarbonate transmembrane transporter activity	ISS
GO:0015108	Function	Chloride transmembrane transporter activity	IBA	21873635
GO:0015108	Function	Chloride transmembrane transporter activity	IMP	20501439
GO:0015108	Function	Chloride transmembrane transporter activity	ISS
GO:0015116	Function	Sulfate transmembrane transporter activity	IBA	21873635
GO:0015116	Function	Sulfate transmembrane transporter activity	IMP	20501439
GO:0015301	Function	Anion:anion antiporter activity	IBA	21873635
GO:0015301	Function	Anion:anion antiporter activity	IMP	20501439
GO:0015301	Function	Anion:anion antiporter activity	ISS
GO:0015499	Function	Formate transmembrane transporter activity	ISS
GO:0015562	Function	Efflux transmembrane transporter activity	ISS
GO:0015660	Function	Formate efflux transmembrane transporter activity	ISS
GO:0015701	Process	Bicarbonate transport	IMP	20501439
GO:0015724	Process	Formate transport	ISS
GO:0015797	Process	Mannitol transport	ISS
GO:0016020	Component	Membrane	ISS
GO:0016021	Component	Integral component of membrane	IDA	11087667
GO:0016323	Component	Basolateral plasma membrane	IDA	11087667
GO:0016324	Component	Apical plasma membrane	IDA	11087667, 20501439
GO:0019531	Function	Oxalate transmembrane transporter activity	IBA	21873635
GO:0019531	Function	Oxalate transmembrane transporter activity	IMP	20501439
GO:0019532	Process	Oxalate transport	IMP	20501439
GO:0019532	Process	Oxalate transport	ISS
GO:0030165	Function	PDZ domain binding	ISS
GO:0030321	Process	Transepithelial chloride transport	IMP	20501439
GO:0030321	Process	Transepithelial chloride transport	ISS
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0031526	Component	Brush border membrane	IDA	11087667
GO:0031982	Component	Vesicle	ISS
GO:0034707	Component	Chloride channel complex	IEA
GO:0042045	Process	Epithelial fluid transport	ISS
GO:0046724	Process	Oxalic acid secretion	ISS
GO:0048240	Process	Sperm capacitation	ISS
GO:0050892	Process	Intestinal absorption	ISS
GO:0051453	Process	Regulation of intracellular pH	IMP	20501439
GO:0051454	Process	Intracellular pH elevation	ISS
GO:0070633	Process	Transepithelial transport	ISS
GO:0071320	Process	Cellular response to cAMP	ISS
GO:0071332	Process	Cellular response to fructose stimulus	ISS
GO:0071346	Process	Cellular response to interferon-gamma	IDA	18655181
GO:0097225	Component	Sperm midpiece	ISS
GO:1902358	Process	Sulfate transmembrane transport	IEA
GO:1902476	Process	Chloride transmembrane transport	IEA
GO:2001150	Process	Positive regulation of dipeptide transmembrane transport	ISS

Other IDs

• MIM: 610068
• HGNC: 14472
• e!Ensembl: ENSG00000225697

Protein

• UniProt ID: Q9BXS9
• Protein name: Solute carrier family 26 member 6 (Anion exchange transporter) (Pendrin-like protein 1) (Pendrin-L1)
• Protein function: Apical membrane anion-exchanger with wide epithelial distribution that plays a role as a component of the pH buffering system for maintaining acid-base homeostasis. Acts as a versatile DIDS-sensitive inorganic and organic anion transporter that
• PDB: 8OPQ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00916	Sulfate_transp	90 → 480	Sulfate permease family	Family
  PF01740	STAS	531 → 738	STAS domain	Domain

• Sequence:

  MGLADASGPRDTQALLSATQAMDLRRRDYHMERPLLNQEHLEELGRWGSAPRTHQWRTWL
  QCSRARAYALLLQHLPVLVWLPRYPVRDWLLGDLLSGLSVAIMQLPQGLAYALLAGLPPV
  FGLYSSFYPVFIYFLFGTSRHISVGTFAVMSVMVGSVTESLAPQALNDSMINETARDAAR
  VQVASTLSVLVGLFQVGLGLIHFGFVVTYLSEPLVRGYTTAAAVQVFVSQLKYVFGLHLS
  SHSGPLSLIYTVLEVCWKLPQSKVGTVVTAAVAGVVLVVVKLLNDKLQQQLPMPIPGELL
  TLIGATGISYGMGLKHRFEVDVVGNIPAGLVPPVAPNTQLFSKLVGSAFTIAVVGFAIAI
  SLGKIFALRHGYRVDSNQELVALGLSNLIGGIFQCFPVSCSMSRSLVQESTGGNSQVAGA
  ISSLFILLIIVKLGELFHDLPKAVLAAIIIVNLKGMLRQLSDMRSLWKANRADLLIWLVT
  FTATILLNLDLGLVVAVIFSLLLVVVRTQMPHYSVLGQVPDTDIYRDVAEYSEAKEVRGV
  KVFRSSATVYFANAEFYSDALKQRCGVDVDFLISQKKKLLKKQEQLKLKQLQKEEKLRKQ
  AASPKGASVSINVNTSLEDMRSNNVEDCKMMQVSSGDKMEDATANGQEDSKAPDGSTLKA
  LGLPQPDFHSLILDLGALSFVDTVCLKSLKNIFHDFREIEVEVYMAACHSPVVSQLEAGH
  FFDASITKKHLFASVHDAVTFALQHPRPVPDSPVSVTRL

• Sequence length: 759

Pathways

KEGG:

Mineral absorption
Chemical carcinogenesis - reactive oxygen species

Reactome:

Multifunctional anion exchangers

Associated diseases

Unknown
Disease name	Disease term	dbSNP ID	References
Liver carcinoma	Liver carcinoma		28284560