GediPNet logo

SIX3 (SIX homeobox 3)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6496
Gene nameGene Name - the full gene name approved by the HGNC.
SIX homeobox 3
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
SIX3
SynonymsGene synonyms aliases
HPE2
ChromosomeChromosome number
2
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2p21
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the sine oculis homeobox transcription factor family. The encoded protein plays a role in eye development. Mutations in this gene have been associated with holoprosencephaly type 2. [provided by RefSeq, Oct 2009]
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT612491 hsa-miR-339-5p HITS-CLIP 19536157
MIRT612490 hsa-miR-6748-3p HITS-CLIP 19536157
MIRT612489 hsa-miR-3679-3p HITS-CLIP 19536157
MIRT612488 hsa-miR-4446-5p HITS-CLIP 19536157
MIRT635884 hsa-miR-10a-3p HITS-CLIP 23824327
Transcription factors
Transcription factor Regulation Reference
PAX6 Activation 11554737
PROX1 Activation 11554737
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 18836447
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID O95343
Protein name Homeobox protein SIX3 (Sine oculis homeobox homolog 3)
Protein function Transcriptional regulator which can act as both a transcriptional repressor and activator by binding a ATTA homeodomain core recognition sequence on these target genes. During forebrain development represses WNT1 expression allowing zona limitan
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16878 SIX1_SD
87 201
Transcriptional regulator, SIX1, N-terminal SD domain
Domain
PF00046 Homeodomain
207 263
Homeodomain
Domain
Sequence
MVFRSPLDLYSSHFLLPNFADSHHRSILLASSGGGNGAGGGGGAGGGSGGGNGAGGGGAG
GAGGGGGGGSRAPPEELSMFQLPTLNFSPEQVASVCETLEETGDIERLGRFLWSLPVAPG
ACEAINKHESILRARAVVAFHTGNFRDLYHILENHKFTKESHGKLQAMWLEAHYQEAEKL
RGRPLGPVDKYRVRKKFPLPR
TIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSKKRELA
QATGLTPTQVGNWFKNRRQRDRA
AAAKNRLQHQAIGPSGMRSLAEPGCPTHGSAESPSTA
ASPTTSVSSLTERADTGTSILSVTSSDSECDV
Sequence length 332
Interactions View interactions
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Agenesis of corpus callosum Agenesis of corpus callosum rs754914260, rs1057519053, rs1057519056, rs1057519054, rs1057519055, rs1057519057, rs1384496494, rs1599017933
Asthma Asthma rs324981, rs121912630, rs150116809, rs4950928, rs708494, rs1581842283
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291, rs886041382, rs1057518991, rs1057518699, rs753254213, rs748294403, rs762552974, rs1135401795, rs1553121073, rs1553122926, rs1364690005, rs1554086554, rs1554210415, rs1554168326, rs1554776342, rs1553873247, rs1567860112, rs779009256, rs1557447255, rs1564568350, rs780011005, rs1597464953, rs1200336864, rs1569513017, rs1587459606, rs1570332505, rs748888652, rs1575155995, rs2087029320, rs1589669105, rs1601769604, rs1184981709, rs749201074
Diabetes insipidus Diabetes Insipidus rs781942628, rs104894747, rs104894748, rs104894749, rs104894750, rs28935496, rs2147483647, rs104894751, rs104894752, rs104894753, rs104894754, rs104894755, rs1569545523, rs104894756, rs104894757, rs104894758, rs104894759, rs104894760, rs121964892, rs104894328, rs104894329, rs1565636541, rs104894334, rs104894330, rs104894331, rs104894335, rs104894332, rs104894333, rs104894337, rs1565637179, rs1565637189, rs28931580, rs104894338, rs104894339, rs104894341, rs796052096, rs886040961, rs370879515, rs1057518723, rs1064797077, rs1131690792, rs1557100304, rs772201159, rs149659001, rs770810694, rs1557100594, rs1603282342, rs749468605
Unknown
Disease name Disease term dbSNP ID References
Alobar holoprosencephaly Alobar Holoprosencephaly 10369266
Ambiguous genitalia Ambiguous Genitalia rs782562963
Arrhinencephaly Arhinencephaly 10369266
Arrhinia Arrhinia

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412