DCLRE1C (DNA cross-link repair 1C)
|
Gene
|
Entrez ID
Entrez Gene ID - the GENE ID in NCBI Gene database.
|
64421 |
Gene nameGene Name - the full gene name approved by the HGNC.
|
DNA cross-link repair 1C |
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
|
DCLRE1C |
SynonymsGene synonyms aliases
|
A-SCID, DCLREC1C, RS-SCID, SCIDA, SNM1C |
ChromosomeChromosome number
|
10 |
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
|
10p13 |
SummarySummary of gene provided in NCBI Entrez Gene.
|
This gene encodes a nuclear protein that is involved in V(D)J recombination and DNA repair. The encoded protein has single-strand-specific 5`-3` exonuclease activity; it also exhibits endonuclease activity on 5` and 3` overhangs and hairpins. The protein |
SNPsSNP information provided by dbSNP.
|
SNP ID |
Visualize variation |
Clinical significance |
Consequence |
rs113870881 |
T>G |
Likely-benign, conflicting-interpretations-of-pathogenicity |
Genic downstream transcript variant, missense variant, non coding transcript variant, coding sequence variant |
rs121908156 |
G>A,T |
Pathogenic |
5 prime UTR variant, synonymous variant, non coding transcript variant, coding sequence variant, stop gained, intron variant |
rs121908157 |
G>A,T |
Pathogenic |
Stop gained, synonymous variant, non coding transcript variant, coding sequence variant |
rs143782439 |
T>C |
Conflicting-interpretations-of-pathogenicity, uncertain-significance |
Genic downstream transcript variant, synonymous variant, non coding transcript variant, coding sequence variant |
rs146832860 |
C>T |
Conflicting-interpretations-of-pathogenicity |
Coding sequence variant, non coding transcript variant, synonymous variant |
rs373709012 |
TTC>- |
Conflicting-interpretations-of-pathogenicity |
Coding sequence variant, inframe deletion, non coding transcript variant, genic downstream transcript variant |
rs757316102 |
G>A |
Likely-pathogenic, uncertain-significance |
Non coding transcript variant, coding sequence variant, missense variant, intron variant, 5 prime UTR variant |
rs786200884 |
TCTACAA>- |
Pathogenic |
Non coding transcript variant, coding sequence variant, frameshift variant, genic downstream transcript variant |
rs786205074 |
C>- |
Pathogenic |
Non coding transcript variant, coding sequence variant, splice donor variant |
rs786205456 |
C>T |
Likely-pathogenic |
Non coding transcript variant, coding sequence variant, missense variant |
rs886037924 |
->T |
Pathogenic |
Non coding transcript variant, coding sequence variant, frameshift variant, genic downstream transcript variant |
rs886037925 |
G>A |
Pathogenic |
Coding sequence variant, intron variant, non coding transcript variant, 5 prime UTR variant, missense variant |
rs1340132582 |
G>C |
Pathogenic |
Stop gained, coding sequence variant, non coding transcript variant |
rs1564414523 |
C>G |
Pathogenic |
Intron variant, splice donor variant |
rs1564418254 |
C>T |
Pathogenic |
Splice donor variant |
rs1564446526 |
C>A |
Pathogenic |
Initiator codon variant, intron variant, splice donor variant |
rs1588893751 |
->C |
Likely-pathogenic |
Genic downstream transcript variant, frameshift variant, coding sequence variant, non coding transcript variant |
rs1588896721 |
->CCTCCTC |
Likely-pathogenic |
Splice acceptor variant, coding sequence variant, non coding transcript variant, genic downstream transcript variant |
rs1589050343 |
G>A |
Pathogenic |
Coding sequence variant, non coding transcript variant, stop gained |
rs1589064324 |
GAACGTAGTATCC>CAACATAGTATCT |
Likely-pathogenic |
Coding sequence variant, missense variant, non coding transcript variant |
rs1589070600 |
->A |
Pathogenic |
Frameshift variant, coding sequence variant, non coding transcript variant |
rs1589136659 |
A>T |
Pathogenic |
Non coding transcript variant, coding sequence variant, 5 prime UTR variant, intron variant, stop gained |
|
miRNAmiRNA information provided by mirtarbase database.
|
|
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
|
|
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
|
|
Protein
|
UniProt ID |
Q96SD1 |
Protein name |
Protein artemis (EC 3.1.-.-) (DNA cross-link repair 1C protein) (Protein A-SCID) (SNM1 homolog C) (hSNM1C) (SNM1-like protein) |
Protein function |
Nuclease involved in DNA non-homologous end joining (NHEJ); required for double-strand break repair and V(D)J recombination (PubMed:11336668, PubMed:11955432, PubMed:12055248, PubMed:14744996, PubMed:15071507, PubMed:15574326, PubMed:15936993). |
PDB |
3W1B
,
3W1G
,
4HTP
,
6TT5
,
6WNL
,
6WO0
,
7ABS
,
7AF1
,
7AFS
,
7AFU
,
7AGI
,
7APV
,
7SGL
,
7TYR
|
Family and domains |
Pfam
Accession |
ID |
Position in sequence |
Description |
Type |
PF07522 |
DRMBL |
239 → 345 |
DNA repair metallo-beta-lactamase |
Domain |
|
Sequence |
MSSFEGQMAEYPTISIDRFDRENLRARAYFLSHCHKDHMKGLRAPTLKRRLECSLKVYLY CSPVTKELLLTSPKYRFWKKRIISIEIETPTQISLVDEASGEKEEIVVTLLPAGHCPGSV MFLFQGNNGTVLYTGDFRLAQGEAARMELLHSGGRVKDIQSVYLDTTFCDPRFYQIPSRE ECLSGVLELVRSWITRSPYHVVWLNCKAAYGYEYLFTNLSEELGVQVHVNKLDMFRNMPE ILHHLTTDRNTQIHACRHPKAEEYFQWSKLPCGITSRNRIPLHIISIKPSTMWFGERSRK TNVIVRTGESSYRACFSFHSSYSEIKDFLSYLCPVNAYPNVIPVGTTMDKVVEILKPLCR SSQSTEPKYKPLGKLKRARTVHRDSEEEDDYLFDDPLPIPLRHKVPYPETFHPEVFSMTA VSEKQPEKLRQTPGCCRAECMQSSRFTNFVDCEESNSESEEEVGIPASLQGDLGSVLHLQ KADGDVPQWEVFFKRNDEITDESLENFPSSTVAGGSQSPKLFSDSDGESTHISSQNSSQS THITEQGSQGWDSQSDTVLLSSQERNSGDITSLDKADYRPTIKENIPASLMEQNVICPKD TYSDLKSRDKDVTIVPSTGEPTTLSSETHIPEEKSLLNLSTNADSQSSSDFEVPSTPEAE LPKREHLQYLYEKLATGESIAVKKRKCSLLDT
|
|
Sequence length |
692 |
Interactions |
View interactions |
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
|
|
Associated diseases
|
Causal |
Disease name |
Disease term |
dbSNP ID |
References |
Anemia |
Anemia |
rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966, rs137853122, rs137853123, rs786205060, rs267607121, rs121908584, rs80338697, rs80338699, rs120074166, rs120074167, rs1050828, rs74575103, rs137852314, rs5030868, rs137852316, rs137852317, rs137852318, rs137852319, rs137852320, rs137852321, rs137852322, rs137852323, rs137852324, rs72554665, rs387906468, rs5030872, rs137852326, rs137852333, rs137852327, rs137852328, rs137852329, rs137852330, rs137852331, rs137852332, rs137852334, rs137852335, rs137852336, rs137852339, rs76645461, rs137852340, rs137852341, rs78478128, rs137852343, rs137852344, rs137852345, rs587776730, rs137852346, rs137852347, rs137852349, rs2070404412, rs2070350038, rs2070350009, rs137852303, rs137852304, rs33946267, rs34378160, rs33933298, rs11549407, rs35724775, rs34598529, rs41469945, rs267607201, rs80338694, rs80338696, rs387907018, rs398123546, rs78365220, rs587777100, rs587777101, rs483352840, rs869312752, rs765487627, rs1557229599, rs1557230040, rs1555524842, rs782090947, rs1358275550, rs1557229736, rs1557230573, rs1556323334, rs1233124208, rs1293528130, rs146864395, rs1595503440, rs1603411214, rs137852325, rs1575247302, rs1603411177, rs1336651679, rs782322505 |
|
Arthritis |
Juvenile arthritis |
rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470 |
|
Combined immunodeficiency |
Severe combined immunodeficiency with sensitivity to ionizing radiation |
rs121908717, rs121908714, rs121908716, rs199422327, rs121908715, rs121908739, rs121908740, rs121908723, rs387906267, rs121908735, rs121908721, rs1194494050, rs2123516908, rs587776534, rs199422328, rs121908722, rs121908730, rs121908731, rs121908725, rs121908733, rs121908719, rs121908727, rs121908724, rs771266745, rs746052951, rs79281338, rs761242509, rs886041796, rs1057520217, rs751635016, rs763595926, rs778809577, rs780014431, rs1555845120, rs528390681, rs778343059, rs1555843178, rs766590645, rs1555844120, rs1312320956, rs1555844006, rs757796081, rs1555844395, rs1555844616, rs1555844617, rs749484894, rs751147673, rs1452483770, rs1568845361, rs758073965, rs1555844600, rs1209280928, rs1600921786, rs2065317387, rs2065325961, rs1225623204, rs1233957241, rs763478578 |
11336668, 12592555, 12921762, 19953608, 12406895, 12569164, 12055248, 25917813, 21147755 |
Hypothyroidism |
Hypothyroidism |
rs869320723, rs121908862, rs121908863, rs121908865, rs121908866, rs121908867, rs121908870, rs121908871, rs121908872, rs2140110277, rs121908881, rs121908884, rs121908885, rs786205080, rs1586182912, rs121917847, rs104893655, rs104893657, rs104893658, rs104893659, rs104893660, rs104893656, rs121917719, rs786204790, rs189261858, rs879255608, rs868197660, rs879255609, rs1586744173, rs1586182837, rs771222349, rs1587618417, rs1601844140, rs760832986, rs780982673, rs1603336347, rs1691155605 |
|
Lymphoma |
Lymphoma |
rs11540652, rs1592119138, rs1592123162, rs1599367044 |
|
Migraine |
Migraine Disorders |
rs794727411 |
23793025 |
Nephrotic syndrome |
Nephrotic Syndrome |
rs876657369, rs121912601, rs121912602, rs876657370, rs121912603, rs121912604, rs121912605, rs121907900, rs121907901, rs28941778, rs587776576, rs28942089, rs587776577, rs28941777, rs121907910, rs1568296260, rs119473033, rs74315342, rs74315343, rs74315345, rs74315346, rs74315347, rs74315348, rs121434394, rs267606919, rs121912488, rs267606953, rs267606954, rs267606955, rs104886210, rs1591732280, rs1591750243, rs140511594, rs140781106, rs147972030, rs587776969, rs386833863, rs386833880, rs386833882, rs386833892, rs386833895, rs386833909, rs386833911, rs386833920, rs386833935, rs386833947, rs1555763603, rs398122978, rs398122979, rs398122980, rs369573693, rs398122981, rs398122982, rs398122983, rs200482683, rs730882194, rs180177201, rs587777552, rs587777553, rs775170915, rs749740335, rs12568913, rs530318579, rs786204583, rs786204708, rs786204632, rs138656762, rs797044992, rs797044994, rs797044995, rs864321632, rs864321687, rs864321688, rs864321633, rs869025495, rs869025541, rs869312747, rs145473779, rs757674160, rs869320695, rs138909849, rs869312984, rs1057516900, rs763818901, rs199506378, rs1057517164, rs1057516523, rs1057516414, rs778055996, rs1057516395, rs1057516747, rs1057516880, rs1057516680, rs778217926, rs1057519347, rs764587648, rs1060499703, rs121907903, rs769259446, rs1131692252, rs1131692253, rs1131692254, rs1131692255, rs1131692256, rs746887949, rs1131692235, rs1135402911, rs1135402912, rs1135402913, rs1554946480, rs1555331969, rs773173317, rs1555816634, rs775006954, rs1320543506, rs534522842, rs1272948499, rs1191455921, rs1291398331, rs1554939785, rs776016942, rs1031744496, rs748812981, rs755972674, rs1553312833, rs967339926, rs1462028977, rs1212702104, rs1167223941, rs762631237, rs1553316575, rs1553315173, rs1553316648, rs1553316611, rs780761368, rs368572297, rs1568070817, rs1321552081, rs1558108130, rs1558091788, rs1565707103, rs1558355124, rs1564622701, rs1351580598, rs1589475328, rs1589413498, rs1572255744, rs1572262824, rs761410195, rs1602413491, rs1590326226, rs375998390, rs570583897, rs369363545, rs201488687, rs1334894971, rs763782471, rs138047529, rs895782232, rs1572255047, rs1589433172, rs1589509476, rs1572277600, rs1572282458, rs1584675898, rs759043857, rs1853443391 |
|
Severe combined immunodeficiency disease |
Severe Combined Immunodeficiency, Combined immunodeficiency, SEVERE COMBINED IMMUNODEFICIENCY, ATHABASKAN-TYPE, Athabaskan severe combined immunodeficiency, SEVERE COMBINED IMMUNODEFICIENCY, PARTIAL, Severe combined immunodeficiency due to DCLRE1C deficiency |
rs886037607, rs118203993, rs121908714, rs121908739, rs121908740, rs121908735, rs121908721, rs121908722, rs121908156, rs1564414523, rs1564418254, rs1564446526, rs786205074, rs121908157, rs121908159, rs786200884, rs397515357, rs104894562, rs137852624, rs137852625, rs137852626, rs137852627, rs137852507, rs137852509, rs111033619, rs111033620, rs1569480018, rs111033621, rs137852510, rs587776729, rs111033622, rs111033617, rs111033618, rs121917894, rs121917896, rs2133313409, rs121917897, rs28933392, rs104894282, rs104894283, rs104894285, rs121918570, rs121918572, rs730880318, rs104893674, rs730880319, rs104894453, rs104894454, rs104894451, rs137853206, rs777503956, rs267606645, rs267606648, rs397515390, rs193922346, rs193922347, rs193922348, rs193922349, rs193922350, rs137852508, rs193922640, rs193922641, rs193922643, rs193922645, rs193922361, rs193922364, rs193922464, rs148508754, rs193922574, rs113994174, rs606231246, rs397514671, rs397514686, rs397514755, rs199474679, rs199474685, rs199474686, rs199474681, rs150739647, rs267605358, rs886041036, rs587777335, rs587778405, rs145092287, rs587777562, rs606231256, rs200296680, rs786205456, rs786205517, rs774202259, rs786205615, rs878853261, rs786205890, rs782753385, rs746052951, rs869025224, rs869312857, rs869320660, rs869320659, rs869320658, rs879253742, rs886037924, rs886037925, rs750610248, rs886039394, rs761242509, rs886039387, rs886041043, rs886041044, rs886042051, rs886041333, rs749481781, rs1057517747, rs1057519506, rs1057523762, rs1057521062, rs1057520644, rs761583890, rs751635016, rs55729925, rs1064793248, rs1064793347, rs1064794027, rs781410769, rs1555524788, rs1486760100, rs769633203, rs1556330713, rs1555322558, rs1556330234, rs1556330755, rs1556329779, rs1556330552, rs1556329822, rs1556330286, rs1556331272, rs2146178281, rs376610445, rs757797994, rs775704953, rs1555743321, rs1564995660, rs1564995662, rs1556330249, rs144104577, rs886041796, rs1026474882, rs570768621, rs1556330562, rs1556330568, rs780014431, rs778343059, rs1555844617, rs1567629968, rs1567628757, rs1567629943, rs1567632864, rs1567632829, rs1567626023, rs1559328006, rs1561423197, rs1452483770, rs1568400897, rs1569479913, rs1568404443, rs1569480047, rs1563340753, rs368303189, rs1568431262, rs1568431102, rs1561424886, rs1602289943, rs1241698978, rs1569479994, rs1569480082, rs1602289649, rs1573261820, rs770985198, rs1589050343, rs1340132582, rs1589064324, rs1589070600, rs1213680890, rs149316157, rs1599873591, rs755706305, rs1602288051, rs1602289411, rs1602289183, rs1583513256, rs1589136659, rs1380154594, rs1011307501, rs1599876167, rs1569967422, rs1602289631, rs1573262398, rs760191638, rs1592117677, rs1640406042, rs372597855, rs1839558393, rs1839622622, rs1839957089, rs777008519, rs1233957241, rs2092261618, rs1839255008, rs1677695565, rs936493226, rs1162344514, rs991089005 |
12055248 |
|
Unknown |
Disease name |
Disease term |
dbSNP ID |
References |
Alopecia |
Alopecia |
|
|
Aphthous ulcer |
Recurrent aphthous ulcer |
|
|
Aplasia of the thymus |
Congenital absence of thymus |
|
|
Congenital hypoplasia of thymus |
Congenital hypoplasia of thymus |
|
|
Eosinophilia |
Eosinophilia |
|
|
Exfoliative dermatitis |
Exfoliative dermatitis |
|
|
Genital ulcers |
Genital ulcers |
|
|
Hashimoto disease |
Hashimoto Disease |
|
|
Hypoproteinemia |
Hypoproteinemia |
|
|
Omenn syndrome |
Omenn Syndrome |
|
15731174, 15071507, 19953608, 25917813 |
Oral ulcer |
Oral Ulcer |
|
|
Otitis media |
Otitis Media |
rs601338, rs1047781, rs1800028 |
|
Reticuloendotheliosis with eosinophilia |
Reticuloendotheliosis, familial, with eosinophilia |
|
|
Thyroiditis |
Thyroiditis |
|
|
Vitiligo |
Vitiligo |
|
|
|
|
|