GediPNet logo

DCLRE1C (DNA cross-link repair 1C)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
64421
Gene nameGene Name - the full gene name approved by the HGNC.
DNA cross-link repair 1C
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
DCLRE1C
SynonymsGene synonyms aliases
A-SCID, DCLREC1C, RS-SCID, SCIDA, SNM1C
ChromosomeChromosome number
10
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10p13
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes a nuclear protein that is involved in V(D)J recombination and DNA repair. The encoded protein has single-strand-specific 5`-3` exonuclease activity; it also exhibits endonuclease activity on 5` and 3` overhangs and hairpins. The protein
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs113870881 T>G Likely-benign, conflicting-interpretations-of-pathogenicity Genic downstream transcript variant, missense variant, non coding transcript variant, coding sequence variant
rs121908156 G>A,T Pathogenic 5 prime UTR variant, synonymous variant, non coding transcript variant, coding sequence variant, stop gained, intron variant
rs121908157 G>A,T Pathogenic Stop gained, synonymous variant, non coding transcript variant, coding sequence variant
rs143782439 T>C Conflicting-interpretations-of-pathogenicity, uncertain-significance Genic downstream transcript variant, synonymous variant, non coding transcript variant, coding sequence variant
rs146832860 C>T Conflicting-interpretations-of-pathogenicity Coding sequence variant, non coding transcript variant, synonymous variant
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT042846 hsa-miR-324-3p CLASH 23622248
MIRT508989 hsa-miR-410-3p HITS-CLIP 21572407
MIRT508988 hsa-miR-5011-5p HITS-CLIP 21572407
MIRT515839 hsa-miR-4495 HITS-CLIP 21572407
MIRT508987 hsa-miR-190a-3p HITS-CLIP 21572407
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000014 Function Single-stranded DNA endodeoxyribonuclease activity IDA 11955432
GO:0002250 Process Adaptive immune response IEA
GO:0003684 Function Damaged DNA binding IBA 21873635
GO:0004519 Function Endonuclease activity TAS
GO:0005515 Function Protein binding IPI 22529269, 23219551, 25941166
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q96SD1
Protein name Protein artemis (EC 3.1.-.-) (DNA cross-link repair 1C protein) (Protein A-SCID) (SNM1 homolog C) (hSNM1C) (SNM1-like protein)
Protein function Nuclease involved in DNA non-homologous end joining (NHEJ); required for double-strand break repair and V(D)J recombination (PubMed:11336668, PubMed:11955432, PubMed:12055248, PubMed:14744996, PubMed:15071507, PubMed:15574326, PubMed:15936993).
PDB 3W1B , 3W1G , 4HTP , 6TT5 , 6WNL , 6WO0 , 7ABS , 7AF1 , 7AFS , 7AFU , 7AGI , 7APV , 7SGL , 7TYR
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07522 DRMBL
239 345
DNA repair metallo-beta-lactamase
Domain
Sequence
MSSFEGQMAEYPTISIDRFDRENLRARAYFLSHCHKDHMKGLRAPTLKRRLECSLKVYLY
CSPVTKELLLTSPKYRFWKKRIISIEIETPTQISLVDEASGEKEEIVVTLLPAGHCPGSV
MFLFQGNNGTVLYTGDFRLAQGEAARMELLHSGGRVKDIQSVYLDTTFCDPRFYQIPSRE
ECLSGVLELVRSWITRSPYHVVWLNCKAAYGYEYLFTNLSEELGVQVHVNKLDMFRNMPE
ILHHLTTDRNTQIHACRHPKAEEYFQWSKLPCGITSRNRIPLHIISIKPSTMWFGERSRK
TNVIVRTGESSYRACFSFHSSYSEIKDFLSYLCPVNAYPNVIPVG
TTMDKVVEILKPLCR
SSQSTEPKYKPLGKLKRARTVHRDSEEEDDYLFDDPLPIPLRHKVPYPETFHPEVFSMTA
VSEKQPEKLRQTPGCCRAECMQSSRFTNFVDCEESNSESEEEVGIPASLQGDLGSVLHLQ
KADGDVPQWEVFFKRNDEITDESLENFPSSTVAGGSQSPKLFSDSDGESTHISSQNSSQS
THITEQGSQGWDSQSDTVLLSSQERNSGDITSLDKADYRPTIKENIPASLMEQNVICPKD
TYSDLKSRDKDVTIVPSTGEPTTLSSETHIPEEKSLLNLSTNADSQSSSDFEVPSTPEAE
LPKREHLQYLYEKLATGESIAVKKRKCSLLDT
Sequence length 692
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  Non-homologous end-joining
Primary immunodeficiency
  Nonhomologous End-Joining (NHEJ)
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Anemia Anemia rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966, rs137853122, rs137853123, rs786205060, rs267607121, rs121908584, rs80338697, rs80338699, rs120074166, rs120074167, rs1050828, rs74575103, rs137852314, rs5030868, rs137852316, rs137852317, rs137852318, rs137852319, rs137852320, rs137852321, rs137852322, rs137852323, rs137852324, rs72554665, rs387906468, rs5030872, rs137852326, rs137852333, rs137852327, rs137852328, rs137852329, rs137852330, rs137852331, rs137852332, rs137852334, rs137852335, rs137852336, rs137852339, rs76645461, rs137852340, rs137852341, rs78478128, rs137852343, rs137852344, rs137852345, rs587776730, rs137852346, rs137852347, rs137852349, rs2070404412, rs2070350038, rs2070350009, rs137852303, rs137852304, rs33946267, rs34378160, rs33933298, rs11549407, rs35724775, rs34598529, rs41469945, rs267607201, rs80338694, rs80338696, rs387907018, rs398123546, rs78365220, rs587777100, rs587777101, rs483352840, rs869312752, rs765487627, rs1557229599, rs1557230040, rs1555524842, rs782090947, rs1358275550, rs1557229736, rs1557230573, rs1556323334, rs1233124208, rs1293528130, rs146864395, rs1595503440, rs1603411214, rs137852325, rs1575247302, rs1603411177, rs1336651679, rs782322505
Arthritis Juvenile arthritis rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470
Combined immunodeficiency Severe combined immunodeficiency with sensitivity to ionizing radiation rs121908717, rs121908714, rs121908716, rs199422327, rs121908715, rs121908739, rs121908740, rs121908723, rs387906267, rs121908735, rs121908721, rs1194494050, rs2123516908, rs587776534, rs199422328, rs121908722, rs121908730, rs121908731, rs121908725, rs121908733, rs121908719, rs121908727, rs121908724, rs771266745, rs746052951, rs79281338, rs761242509, rs886041796, rs1057520217, rs751635016, rs763595926, rs778809577, rs780014431, rs1555845120, rs528390681, rs778343059, rs1555843178, rs766590645, rs1555844120, rs1312320956, rs1555844006, rs757796081, rs1555844395, rs1555844616, rs1555844617, rs749484894, rs751147673, rs1452483770, rs1568845361, rs758073965, rs1555844600, rs1209280928, rs1600921786, rs2065317387, rs2065325961, rs1225623204, rs1233957241, rs763478578 11336668, 12592555, 12921762, 19953608, 12406895, 12569164, 12055248, 25917813, 21147755
Hypothyroidism Hypothyroidism rs869320723, rs121908862, rs121908863, rs121908865, rs121908866, rs121908867, rs121908870, rs121908871, rs121908872, rs2140110277, rs121908881, rs121908884, rs121908885, rs786205080, rs1586182912, rs121917847, rs104893655, rs104893657, rs104893658, rs104893659, rs104893660, rs104893656, rs121917719, rs786204790, rs189261858, rs879255608, rs868197660, rs879255609, rs1586744173, rs1586182837, rs771222349, rs1587618417, rs1601844140, rs760832986, rs780982673, rs1603336347, rs1691155605
Unknown
Disease name Disease term dbSNP ID References
Alopecia Alopecia
Aphthous ulcer Recurrent aphthous ulcer
Aplasia of the thymus Congenital absence of thymus
Congenital hypoplasia of thymus Congenital hypoplasia of thymus

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412