SFTPD (surfactant protein D)

Gene

• Entrez ID: 6441
• Gene name: Surfactant protein D
• Gene symbol: SFTPD
• Synonyms: COLEC7, PSP-D, SFTP4, SP-D
• Chromosome: 10
• Chromosome location: 10q22.3
• Summary: The protein encoded by this gene is part of the innate immune response, protecting the lungs against inhaled microorganisms and chemicals. The encoded protein may also be involved in surfactant metabolism. [provided by RefSeq, Jul 2015]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019062	hsa-miR-335-5p	Microarray	18185580

Transcription factors

Transcription factor	Regulation	Reference
CEBPA	Activation	11912209
CEBPB	Activation	11912209
CEBPG	Activation	11912209
FOSL1	Unknown	10915785
JUNB	Unknown	10915785
JUND	Unknown	10915785
RB1	Activation	11596110

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001817	Process	Regulation of cytokine production	NAS	9751757
GO:0002224	Process	Toll-like receptor signaling pathway	TAS
GO:0005515	Function	Protein binding	IPI	12884308, 28228557
GO:0005576	Component	Extracellular region	TAS	9751757
GO:0005581	Component	Collagen trimer	IEA
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005764	Component	Lysosome	TAS	10485905
GO:0005771	Component	Multivesicular body	IBA	21873635
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005791	Component	Rough endoplasmic reticulum	IBA	21873635
GO:0006898	Process	Receptor-mediated endocytosis	TAS	10485905
GO:0007585	Process	Respiratory gaseous exchange by respiratory system	IEA
GO:0030139	Component	Endocytic vesicle	TAS	10485905
GO:0030246	Function	Carbohydrate binding	TAS	10485905
GO:0032703	Process	Negative regulation of interleukin-2 production	TAS	10485905
GO:0042130	Process	Negative regulation of T cell proliferation	TAS	10485905
GO:0042742	Process	Defense response to bacterium	TAS	9751757
GO:0043129	Process	Surfactant homeostasis	IBA	21873635
GO:0043129	Process	Surfactant homeostasis	IMP	9751757
GO:0043152	Process	Induction of bacterial agglutination	IMP	28228557
GO:0044267	Process	Cellular protein metabolic process	TAS
GO:0045087	Process	Innate immune response	TAS	10485905
GO:0045334	Component	Clathrin-coated endocytic vesicle	TAS
GO:0048246	Process	Macrophage chemotaxis	TAS	10485905
GO:0048286	Process	Lung alveolus development	IMP	9751757
GO:0050766	Process	Positive regulation of phagocytosis	IBA	21873635
GO:0050766	Process	Positive regulation of phagocytosis	TAS	10485905
GO:0050776	Process	Regulation of immune response	TAS
GO:0052405	Process	Negative regulation by host of symbiont molecular function	IDA	28228557
GO:0072593	Process	Reactive oxygen species metabolic process	TAS	10485905
GO:1905226	Process	Regulation of adhesion of symbiont to host epithelial cell	IDA	28228557

Other IDs

• MIM: 178635
• HGNC: 10803
• e!Ensembl: ENSG00000133661

Protein

• UniProt ID: P35247
• Protein name: Pulmonary surfactant-associated protein D (PSP-D) (SP-D) (Collectin-7) (Lung surfactant protein D)
• Protein function: Contributes to the lung's defense against inhaled microorganisms, organic antigens and toxins. Interacts with compounds such as bacterial lipopolysaccharides, oligosaccharides and fatty acids and modulates leukocyte action in immune response. Ma
• PDB: 1B08, 1M7L, 1PW9, 1PWB, 2GGU, 2GGX, 2ORJ, 2ORK, 2OS9, 2RIA, 2RIB, 2RIC, 2RID, 2RIE, 3DBZ, 3G81, 3G83, 3G84, 3IKN, 3IKP, 3IKQ, 3IKR, 4E52, 4M17, 4M18, 5OXR, 5OXS
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01391	Collagen	42 → 105	Collagen triple helix repeat (20 copies)	Repeat
  PF01391	Collagen	163 → 224	Collagen triple helix repeat (20 copies)	Repeat
  PF09006	Surfac_D-trimer	224 → 269	Lung surfactant protein D coiled-coil trimerisation	Coiled-coil
  PF00059	Lectin_C	271 → 375	Lectin C-type domain	Domain

• Sequence:

  MLLFLLSALVLLTQPLGYLEAEMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPR
  GEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGRE
  GPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNT
  GAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQH
  LQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAAL
  QQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKW
  NDRACGEKRLVVCEF

• Sequence length: 375

Pathways

KEGG:

Phagosome

Reactome:

Toll Like Receptor 4 (TLR4) Cascade
Toll Like Receptor TLR1:TLR2 Cascade
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Signal regulatory protein family interactions
Surfactant metabolism
Regulation of TLR by endogenous ligand
Defective CSF2RB causes pulmonary surfactant metabolism dysfunction 5 (SMDP5)
Defective CSF2RA causes pulmonary surfactant metabolism dysfunction 4 (SMDP4)

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Chronic obstructive pulmonary disease	Chronic Obstructive Airway Disease	rs2227956, rs1008438, rs1043618, rs562047, rs1061581, rs2763979, rs6457452, rs13147758, rs1828591, rs13118928	30804561, 28166215, 23144326
Lung cancer	Malignant neoplasm of lung	rs121913530, rs121913529, rs878855122, rs1057519784, rs770315135	15136449, 14522914
Rheumatoid arthritis	Rheumatoid Arthritis	rs3766379, rs3792876, rs2071592, rs3087456, rs587776843, rs1566328963, rs2240340, rs1557787212	24390342, 30423114

Unknown
Disease name	Disease term	dbSNP ID	References
Lung neoplasms	Lung Neoplasms		15136449, 14522914