DNAJC1 (DnaJ heat shock protein family (Hsp40) member C1)

Gene

• Entrez ID: 64215
• Gene name: DnaJ heat shock protein family (Hsp40) member C1
• Gene symbol: DNAJC1
• Synonyms: DNAJL1, ERdj1, HTJ1, MTJ1
• Chromosome: 10
• Chromosome location: 10p12.31
• Summary: The membrane protein encoded by this gene is a DNAJ-like heat shock protein that binds the molecular chaperone BiP. In addition, the encoded protein contains two SANT domains that have been shown to bind serpin alpha1-antichymotrypsin and inter-alpha tryp

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT002721	hsa-miR-124-3p	Microarray	15685193
MIRT002721	hsa-miR-124-3p	Microarray	15685193
MIRT002721	hsa-miR-124-3p	Microarray	18668037
MIRT031667	hsa-miR-16-5p	Proteomics	18668040
MIRT032341	hsa-let-7b-5p	Proteomics	18668040
MIRT940550	hsa-let-7a	CLIP-seq
MIRT940551	hsa-let-7b	CLIP-seq
MIRT940552	hsa-let-7c	CLIP-seq
MIRT940553	hsa-let-7d	CLIP-seq
MIRT940554	hsa-let-7e	CLIP-seq
MIRT940555	hsa-let-7f	CLIP-seq
MIRT940556	hsa-let-7g	CLIP-seq
MIRT940557	hsa-let-7i	CLIP-seq
MIRT940558	hsa-miR-124	CLIP-seq
MIRT940559	hsa-miR-1277	CLIP-seq
MIRT940560	hsa-miR-202	CLIP-seq
MIRT940561	hsa-miR-3148	CLIP-seq
MIRT940562	hsa-miR-3646	CLIP-seq
MIRT940563	hsa-miR-3662	CLIP-seq
MIRT940564	hsa-miR-3714	CLIP-seq
MIRT940565	hsa-miR-3910	CLIP-seq
MIRT940566	hsa-miR-3978	CLIP-seq
MIRT940567	hsa-miR-4458	CLIP-seq
MIRT940568	hsa-miR-4461	CLIP-seq
MIRT940569	hsa-miR-4500	CLIP-seq
MIRT940570	hsa-miR-4662a-3p	CLIP-seq
MIRT940571	hsa-miR-4698	CLIP-seq
MIRT940572	hsa-miR-4757-3p	CLIP-seq
MIRT940573	hsa-miR-4795-3p	CLIP-seq
MIRT940574	hsa-miR-493	CLIP-seq
MIRT940575	hsa-miR-506	CLIP-seq
MIRT940576	hsa-miR-513a-3p	CLIP-seq
MIRT940577	hsa-miR-544	CLIP-seq
MIRT940578	hsa-miR-579	CLIP-seq
MIRT940579	hsa-miR-664	CLIP-seq
MIRT940580	hsa-miR-98	CLIP-seq
MIRT940550	hsa-let-7a	CLIP-seq
MIRT940551	hsa-let-7b	CLIP-seq
MIRT940552	hsa-let-7c	CLIP-seq
MIRT940553	hsa-let-7d	CLIP-seq
MIRT940554	hsa-let-7e	CLIP-seq
MIRT940555	hsa-let-7f	CLIP-seq
MIRT940556	hsa-let-7g	CLIP-seq
MIRT940557	hsa-let-7i	CLIP-seq
MIRT940560	hsa-miR-202	CLIP-seq
MIRT940567	hsa-miR-4458	CLIP-seq
MIRT940568	hsa-miR-4461	CLIP-seq
MIRT940569	hsa-miR-4500	CLIP-seq
MIRT940571	hsa-miR-4698	CLIP-seq
MIRT940576	hsa-miR-513a-3p	CLIP-seq
MIRT940577	hsa-miR-544	CLIP-seq
MIRT940580	hsa-miR-98	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001671	Function	ATPase activator activity	TAS	14668352
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	14668352, 16271702, 32296183, 32814053
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0006417	Process	Regulation of translation	IEA
GO:0006457	Process	Protein folding	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016021	Component	Integral component of membrane	IEA
GO:0031965	Component	Nuclear membrane	IEA
GO:0032781	Process	Positive regulation of ATPase activity	IEA
GO:0045861	Process	Negative regulation of proteolysis	TAS	14668352
GO:0050708	Process	Regulation of protein secretion	IDA	14668352
GO:0051087	Function	Chaperone binding	IEA

Other IDs

• MIM: 611207
• HGNC: 20090
• e!Ensembl: ENSG00000136770

Protein

• UniProt ID: Q96KC8
• Protein name: DnaJ homolog subfamily C member 1 (DnaJ protein homolog MTJ1)
• Protein function: May modulate protein synthesis.
• PDB: 2CQQ, 2CQR
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00226	DnaJ	65 → 126	DnaJ domain	Domain
  PF00249	Myb_DNA-binding	494 → 543	Myb-like DNA-binding domain	Domain

• Sequence:

  MTAPCSQPAQLPGRRQLGLVPFPPPPPRTPLLWLLLLLLAAVAPARGWESGDLELFDLVE
  EVQLNFYQFLGVQQDASSADIRKAYRKLSLTLHPDKNKDENAETQFRQLVAIYEVLKDDE
  RRQRYDDILINGLPDWRQPVFYYRRVRKMSNAELALLLFIILTVGHYAVVWSIYLEKQLD
  ELLSRKKREKKKKTGSKSVDVSKLGASEKNERLLMKPQWHDLLPCKLGIWFCLTLKALPH
  LIQDAGQFYAKYKETRLKEKEDALTRTELETLQKQKKVKKPKPEFPVYTPLETTYIQSYD
  HGTSIEEIEEQMDDWLENRNRTQKKQAPEWTEEDLSQLTRSMVKFPGGTPGRWEKIAHEL
  GRSVTDVTTKAKQLKDSVTCSPGMVRLSELKSTVQNSRPIKTATTLPDDMITQREDAEGV
  AAEEEQEGDSGEQETGATDARPRRRKPARLLEATAKPEPEEKSRAKRQKDFDIAEQNESS
  DEESLRKERARSAEEPWTQNQQKLLELALQQYPRGSSDRWDKIARCVPSKSKEDCIARYK
  LLVELVQKKKQAKS

• Sequence length: 554

Pathways

KEGG:

Protein processing in endoplasmic reticulum

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Breast carcinoma	Breast Carcinoma	rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451, rs397507859, rs80359709, rs80359742, rs80359205, rs80357627, rs80357004, rs80357571, rs80357767, rs80357653, rs80358086, rs80357608, rs28897696, rs41293465, rs146650273, rs63751017, rs63750617, rs63750726, rs63750199, rs63749848, rs398122618, rs398122653, rs397509211, rs80357791, rs121912666, rs587778541, rs121908698, rs536907995, rs587781302, rs140342925, rs587781506, rs587782652, rs587782849, rs587783057, rs10520699, rs11852999, rs139770721, rs374950566, rs786202800, rs863224451, rs377153250, rs747727055, rs876658804, rs780001540, rs760815829, rs878854926, rs775248597, rs886040658, rs886040192, rs786203523, rs886040319, rs397508006, rs587782011, rs1060502772, rs1555461727, rs1553333072, rs1114167702, rs1257401983, rs886040950, rs1060502759, rs774684620, rs142947311, rs1555580883, rs748513310, rs376170600, rs863224499, rs1593909229, rs748453607, rs1294578913, rs1574737047, rs1593909960, rs2081922847, rs2082559544, rs2053694038	29059683
Leukemia	Leukemia, Myelocytic, Acute	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297, rs11978267, rs4132601	27903959
Melanoma	melanoma	rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs1563902635, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340, rs398123152, rs587780668, rs587782083, rs587782206, rs587782792, rs180177042, rs121913381, rs730881675, rs730881674, rs730881677, rs730881673, rs1800586, rs768966657, rs587778189, rs786204195, rs121913321, rs45476696, rs864622636, rs864622263, rs869025340, rs876660436, rs876658534, rs876658556, rs878853647, rs878853644, rs878853650, rs886041162, rs121913389, rs1057519852, rs121913384, rs121913387, rs1060501266, rs1060501263, rs1060501262, rs749714198, rs1060501265, rs559848002, rs1064794292, rs1131691187, rs1131691186, rs199907548, rs1554654052, rs1554656411, rs1554656624, rs1554653915, rs1554653956, rs1554656253, rs1554654224, rs754806883, rs1057520039, rs1563889584, rs1563889685, rs1287464120, rs1563888944, rs1563892715, rs1563889847, rs141798398, rs1587332338, rs1587340291, rs11552823, rs561034503, rs138677674, rs1819962958, rs1820531050	22535842
Parkinson disease	Parkinson Disease	rs116074753, rs118203903, rs118203904, rs115735611, rs33939927, rs35801418, rs34805604, rs35870237, rs34995376, rs74315355, rs28940284, rs74315356, rs74315357, rs28940285, rs730880302, rs750664040, rs74315359, rs74315360, rs45539432, rs74315361, rs119451946, rs80356771, rs74500255, rs75822236, rs1141814, rs78973108, rs121908681, rs121908686, rs121908687, rs137853054, rs137853055, rs137853056, rs137853057, rs137853058, rs137853059, rs34424986, rs137853060, rs397518439, rs28938172, rs74315351, rs74315353, rs137853051, rs118192098, rs121917767, rs121918104, rs1589451049, rs104893877, rs104893878, rs283413, rs112176450, rs111290936, rs188286943, rs387906863, rs387906864, rs774631197, rs199935023, rs387906942, rs397514694, rs398122403, rs398122404, rs398122405, rs104886460, rs409652, rs431905511, rs63751392, rs756677845, rs864309527, rs864309650, rs750014782, rs1554391082, rs864622011, rs869312810, rs869312809, rs869312811, rs369100678, rs879253853, rs869320761, rs747506979, rs879255630, rs886039854, rs191486604, rs781442277, rs1060499619, rs751037529, rs55777503, rs768091663, rs34208370, rs1553122929, rs772786691, rs754809877, rs1555907463, rs1557561340, rs781600849, rs141263564, rs1557901552, rs777160388, rs756783990, rs867929413, rs1237637353, rs1005937012, rs755000580, rs747427602, rs1578089802, rs771586218, rs748142049, rs1582953433, rs746646126, rs771529549, rs121918106	17052657