GediPNet logo

SDC4 (syndecan 4)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6385
Gene nameGene Name - the full gene name approved by the HGNC.
Syndecan 4
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
SDC4
SynonymsGene synonyms aliases
SYND4
ChromosomeChromosome number
20
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20q13.12
SummarySummary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a transmembrane (type I) heparan sulfate proteoglycan that functions as a receptor in intracellular signaling. The encoded protein is found as a homodimer and is a member of the syndecan proteoglycan family. This gene i
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT002795 hsa-miR-1-3p Microarray 15685193
MIRT022356 hsa-miR-124-3p Microarray 18668037
MIRT002795 hsa-miR-1-3p Proteomics;Microarray 18668037
MIRT002795 hsa-miR-1-3p Microarray 15685193
MIRT438457 hsa-miR-18a-5p Luciferase reporter assay, qRT-PCR 25089138
Transcription factors
Transcription factor Regulation Reference
POU2F1 Unknown 19212692
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001523 Process Retinoid metabolic process TAS
GO:0001657 Process Ureteric bud development IEA
GO:0001843 Process Neural tube closure IEA
GO:0001968 Function Fibronectin binding IEA
GO:0005080 Function Protein kinase C binding IEA
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID P31431
Protein name Syndecan-4 (SYND4) (Amphiglycan) (Ryudocan core protein)
Protein function Cell surface proteoglycan which regulates exosome biogenesis in concert with SDCBP and PDCD6IP (PubMed:22660413).
PDB 1EJP , 1EJQ , 1OBY , 1YBO , 8BLV
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01034 Syndecan
139 196
Syndecan domain
Family
Sequence
MAPARLFALLLFFVGGVAESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFEL
SGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVE
ESEDVSNKVSMSSTVQGSNIFERTEVLAALIVGGIVGILFAVFLILLLMYRMKKKDEGSY
DLGKKPIYKKAPTNEF
YA
Sequence length 198
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  ECM-receptor interaction
Cell adhesion molecules
Cytoskeleton in muscle cells
Proteoglycans in cancer
Fluid shear stress and atherosclerosis
  A tetrasaccharide linker sequence is required for GAG synthesis
HS-GAG biosynthesis
HS-GAG degradation
Cell surface interactions at the vascular wall
Syndecan interactions
Defective B4GALT7 causes EDS, progeroid type
Defective B3GAT3 causes JDSSDHD
Defective EXT2 causes exostoses 2
Defective EXT1 causes exostoses 1, TRPS2 and CHDS
Defective B3GALT6 causes EDSP2 and SEMDJL1
Retinoid metabolism and transport
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Lung carcinoma Non-Small Cell Lung Carcinoma rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355, rs121912470, rs121913273, rs121913281, rs121913348, rs727503093, rs121913353, rs397516890, rs397516896, rs121913378, rs397516897, rs397516977, rs397516978, rs397516979, rs397516980, rs397516981, rs397516982, rs121913240, rs17851045, rs397517086, rs121913428, rs397517094, rs397517098, rs397517106, rs121913465, rs397517108, rs397517111, rs397517112, rs397517114, rs397517116, rs1554350366, rs397517127, rs397517200, rs397517202, rs121913283, rs121913370, rs121913357, rs727503106, rs121913238, rs727503108, rs397517040, rs397516976, rs1555618025, rs1057519729, rs1584238193 22919003

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412