CCL23 (C-C motif chemokine ligand 23)

Gene

• Entrez ID: 6368
• Gene name: C-C motif chemokine ligand 23
• Gene symbol: CCL23
• Synonyms: CK-BETA-8, CKb8, Ckb-8, Ckb-8-1, MIP-3, MIP3, MPIF-1, SCYA23, hmrp-2a
• Chromosome: 17
• Chromosome location: 17q12
• Summary: This gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002548	Process	Monocyte chemotaxis	IBA	21873635
GO:0002548	Process	Monocyte chemotaxis	IC	10660125
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0006874	Process	Cellular calcium ion homeostasis	TAS	9886417
GO:0006935	Process	Chemotaxis	TAS	9104803
GO:0006954	Process	Inflammatory response	IBA	21873635
GO:0006955	Process	Immune response	TAS	9104803
GO:0007165	Process	Signal transduction	NAS	9886417
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007267	Process	Cell-cell signaling	TAS	9104803
GO:0008009	Function	Chemokine activity	IBA	21873635
GO:0008009	Function	Chemokine activity	IDA	10660125
GO:0008201	Function	Heparin binding	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	9104803
GO:0030593	Process	Neutrophil chemotaxis	IBA	21873635
GO:0031726	Function	CCR1 chemokine receptor binding	IPI	10660125
GO:0043547	Process	Positive regulation of GTPase activity	IBA	21873635
GO:0048020	Function	CCR chemokine receptor binding	IBA	21873635
GO:0048247	Process	Lymphocyte chemotaxis	IBA	21873635
GO:0070098	Process	Chemokine-mediated signaling pathway	IBA	21873635
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IBA	21873635
GO:0071346	Process	Cellular response to interferon-gamma	IBA	21873635
GO:0071347	Process	Cellular response to interleukin-1	IBA	21873635
GO:0071356	Process	Cellular response to tumor necrosis factor	IBA	21873635
GO:2001264	Process	Negative regulation of C-C chemokine binding	IDA	10660125

Other IDs

• MIM: 602494
• HGNC: 10622
• e!Ensembl: ENSG00000274736

Protein

• UniProt ID: P55773
• Protein name: C-C motif chemokine 23 (CK-beta-8) (CKB-8) (Macrophage inflammatory protein 3) (MIP-3) (Myeloid progenitor inhibitory factor 1) (MPIF-1) (Small-inducible cytokine A23) [Cleaved into: CCL23(19-99); CCL23(22-99); CCL23(27-99); CCL23(30-99)]
• Protein function: Shows chemotactic activity for monocytes, resting T-lymphocytes, and neutrophils, but not for activated lymphocytes. Inhibits proliferation of myeloid progenitor cells in colony formation assays. This protein can bind heparin. Binds CCR1. CCL23(
• PDB: 1G91
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00048	IL8	52 → 109	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

• Sequence:

  MKVSVAALSCLMLVTALGSQARVTKDAETEFMMSKLPLENPVLLDRFHATSADCCISYTP
  RSIPCSLLESYFETNSECSKPGVIFLTKKGRRFCANPSDKQVQVCVRMLKLDTRIKTRKN
  

• Sequence length: 120

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway

Reactome:

G alpha (q) signalling events
G alpha (i) signalling events
Formyl peptide receptors bind formyl peptides and many other ligands

Associated diseases

Unknown
Disease name	Disease term	dbSNP ID	References
Malignant mesothelioma	Malignant mesothelioma		23056237