CCL21 (C-C motif chemokine ligand 21)

Gene

• Entrez ID: 6366
• Gene name: C-C motif chemokine ligand 21
• Gene symbol: CCL21
• Synonyms: 6Ckine, CKb9, ECL, SCYA21, SLC, TCA4
• Chromosome: 9
• Chromosome location: 9p13.3
• Summary: This antimicrobial gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adj

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT870952	hsa-miR-3150a-3p	CLIP-seq
MIRT870953	hsa-miR-3175	CLIP-seq
MIRT870954	hsa-miR-342-5p	CLIP-seq
MIRT870955	hsa-miR-3682-3p	CLIP-seq
MIRT870956	hsa-miR-4502	CLIP-seq
MIRT870957	hsa-miR-4651	CLIP-seq
MIRT870958	hsa-miR-4664-5p	CLIP-seq
MIRT870959	hsa-miR-4667-5p	CLIP-seq
MIRT870960	hsa-miR-4685-5p	CLIP-seq
MIRT870961	hsa-miR-4700-5p	CLIP-seq
MIRT870962	hsa-miR-608	CLIP-seq
MIRT870963	hsa-miR-939	CLIP-seq
MIRT2195369	hsa-miR-125a-5p	CLIP-seq
MIRT2195370	hsa-miR-125b	CLIP-seq
MIRT2195371	hsa-miR-296-5p	CLIP-seq
MIRT2195372	hsa-miR-3918	CLIP-seq
MIRT2195373	hsa-miR-4319	CLIP-seq
MIRT870960	hsa-miR-4685-5p	CLIP-seq
MIRT2195374	hsa-miR-604	CLIP-seq
MIRT2195375	hsa-miR-647	CLIP-seq
MIRT870960	hsa-miR-4685-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFKB2	Activation	20953353
RELB	Activation	20953353

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001768	Process	Establishment of T cell polarity	IDA	12729902
GO:0001771	Process	Immunological synapse formation	ISS
GO:0001954	Process	Positive regulation of cell-matrix adhesion	IDA	15569314, 18308860
GO:0002407	Process	Dendritic cell chemotaxis	IDA	15778365
GO:0002548	Process	Monocyte chemotaxis	IBA	21873635
GO:0002606	Process	Positive regulation of dendritic cell antigen processing and presentation	ISS
GO:0005515	Function	Protein binding	IPI	14978162, 28381538, 32296183, 32814053
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0006954	Process	Inflammatory response	IBA	21873635
GO:0006954	Process	Inflammatory response	NAS	14592837
GO:0006955	Process	Immune response	TAS	10861057
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	18308860
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007267	Process	Cell-cell signaling	TAS	9235955
GO:0008009	Function	Chemokine activity	IBA	21873635
GO:0008009	Function	Chemokine activity	IDA	15778365, 18308860
GO:0008009	Function	Chemokine activity	ISS
GO:0010560	Process	Positive regulation of glycoprotein biosynthetic process	ISS
GO:0010820	Process	Positive regulation of T cell chemotaxis	ISS
GO:0030593	Process	Neutrophil chemotaxis	IBA	21873635
GO:0030838	Process	Positive regulation of actin filament polymerization	IDA	11242036
GO:0031274	Process	Positive regulation of pseudopodium assembly	IDA	11242036
GO:0031295	Process	T cell costimulation	ISS
GO:0031529	Process	Ruffle organization	IDA	15569314
GO:0031732	Function	CCR7 chemokine receptor binding	ISS
GO:0033630	Process	Positive regulation of cell adhesion mediated by integrin	IDA	15569314
GO:0034695	Process	Response to prostaglandin E	IDA	14592837
GO:0035759	Process	Mesangial cell-matrix adhesion	IDA	15569314
GO:0038116	Process	Chemokine (C-C motif) ligand 21 signaling pathway	ISS
GO:0042379	Function	Chemokine receptor binding	IDA	23341447
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	15059845
GO:0043547	Process	Positive regulation of GTPase activity	IBA	21873635
GO:0043552	Process	Positive regulation of phosphatidylinositol 3-kinase activity	IDA	15059845, 15778365
GO:0045860	Process	Positive regulation of protein kinase activity	IDA	15059845
GO:0046330	Process	Positive regulation of JNK cascade	IDA	15778365
GO:0048020	Function	CCR chemokine receptor binding	IBA	21873635
GO:0048245	Process	Eosinophil chemotaxis	IBA	21873635
GO:0048247	Process	Lymphocyte chemotaxis	IBA	21873635
GO:0048260	Process	Positive regulation of receptor-mediated endocytosis	ISS
GO:0048469	Process	Cell maturation	ISS
GO:0050921	Process	Positive regulation of chemotaxis	ISS
GO:0051209	Process	Release of sequestered calcium ion into cytosol	IDA	14592837
GO:0051491	Process	Positive regulation of filopodium assembly	IDA	15569314
GO:0051897	Process	Positive regulation of protein kinase B signaling	IDA	15059845, 15778365
GO:0060326	Process	Cell chemotaxis	IDA	18308860
GO:0070098	Process	Chemokine-mediated signaling pathway	IBA	21873635
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IBA	21873635
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	12729902, 15778365
GO:0071346	Process	Cellular response to interferon-gamma	IBA	21873635
GO:0071347	Process	Cellular response to interleukin-1	IBA	21873635
GO:0071356	Process	Cellular response to tumor necrosis factor	IBA	21873635
GO:0090023	Process	Positive regulation of neutrophil chemotaxis	IDA	21051556
GO:0090630	Process	Activation of GTPase activity	IDA	15778365
GO:0097026	Process	Dendritic cell dendrite assembly	ISS
GO:1903237	Process	Negative regulation of leukocyte tethering or rolling	IDA	18308860
GO:1990869	Process	Cellular response to chemokine	ISS
GO:2000147	Process	Positive regulation of cell motility	IDA	15778365
GO:2000406	Process	Positive regulation of T cell migration	IDA	23620790
GO:2000529	Process	Positive regulation of myeloid dendritic cell chemotaxis	IDA	14592837
GO:2000548	Process	Negative regulation of dendritic cell dendrite assembly	ISS
GO:2000669	Process	Negative regulation of dendritic cell apoptotic process	IDA	15059845

Other IDs

• MIM: 602737
• HGNC: 10620
• e!Ensembl: ENSG00000137077

Protein

• UniProt ID: O00585
• Protein name: C-C motif chemokine 21 (6Ckine) (Beta-chemokine exodus-2) (Secondary lymphoid-tissue chemokine) (SLC) (Small-inducible cytokine A21)
• Protein function: Inhibits hemopoiesis and stimulates chemotaxis. Chemotactic in vitro for thymocytes and activated T-cells, but not for B-cells, macrophages, or neutrophils. Shows preferential activity towards naive T-cells. May play a role in mediating homing o
• PDB: 2L4N, 5EKI
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00048	IL8	29 → 90	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

• Sequence:

  MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIP
  AILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSK
  GCKRTERSQTPKGP

• Sequence length: 134

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway
NF-kappa B signaling pathway

Reactome:

Chemokine receptors bind chemokines
G alpha (i) signalling events

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Rheumatoid arthritis	Rheumatoid Arthritis	rs3766379, rs3792876, rs2071592, rs3087456, rs587776843, rs1566328963, rs2240340, rs1557787212	23143596, 20453842, 18794853