CCL19 (C-C motif chemokine ligand 19)

Gene

• Entrez ID: 6363
• Gene name: C-C motif chemokine ligand 19
• Gene symbol: CCL19
• Synonyms: CKb11, ELC, MIP-3b, MIP3B, SCYA19
• Chromosome: 9
• Chromosome location: 9p13.3
• Summary: This antimicrobial gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adj

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018017	hsa-miR-335-5p	Microarray	18185580
MIRT019331	hsa-miR-148b-3p	Microarray	17612493
MIRT021321	hsa-miR-9-5p	Microarray	17612493
MIRT870944	hsa-miR-3664-5p	CLIP-seq
MIRT870945	hsa-miR-4256	CLIP-seq
MIRT870946	hsa-miR-4651	CLIP-seq
MIRT870947	hsa-miR-4714-5p	CLIP-seq
MIRT870948	hsa-miR-608	CLIP-seq
MIRT870949	hsa-miR-646	CLIP-seq
MIRT2195365	hsa-miR-329	CLIP-seq
MIRT2195366	hsa-miR-342-3p	CLIP-seq
MIRT2195367	hsa-miR-362-3p	CLIP-seq
MIRT2195368	hsa-miR-377	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFKB1	Activation	20953353
NFKB1	Unknown	17182562
RELA	Unknown	17182562
RELB	Activation	20953353

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001768	Process	Establishment of T cell polarity	IDA	12729902
GO:0001771	Process	Immunological synapse formation	ISS
GO:0002407	Process	Dendritic cell chemotaxis	IDA	15778365
GO:0002408	Process	Myeloid dendritic cell chemotaxis	IDA	14592837
GO:0002548	Process	Monocyte chemotaxis	IBA	21873635
GO:0002606	Process	Positive regulation of dendritic cell antigen processing and presentation	ISS
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0006874	Process	Cellular calcium ion homeostasis	TAS	9153236
GO:0006954	Process	Inflammatory response	IBA	21873635
GO:0006954	Process	Inflammatory response	NAS	14592837
GO:0006955	Process	Immune response	TAS	10861057
GO:0007154	Process	Cell communication	TAS	9153236
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007257	Process	Activation of JUN kinase activity	ISS
GO:0008009	Function	Chemokine activity	IBA	21873635
GO:0008009	Function	Chemokine activity	IDA	15778365
GO:0009615	Process	Response to virus	TAS	9153236
GO:0010560	Process	Positive regulation of glycoprotein biosynthetic process	ISS
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0030593	Process	Neutrophil chemotaxis	IBA	21873635
GO:0031295	Process	T cell costimulation	ISS
GO:0031732	Function	CCR7 chemokine receptor binding	ISS
GO:0031735	Function	CCR10 chemokine receptor binding	IDA	10706668
GO:0032731	Process	Positive regulation of interleukin-1 beta production	ISS
GO:0032735	Process	Positive regulation of interleukin-12 production	ISS
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS
GO:0034695	Process	Response to prostaglandin E	IDA	14592837
GO:0042102	Process	Positive regulation of T cell proliferation	ISS
GO:0042379	Function	Chemokine receptor binding	IDA	23341447
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	15059845
GO:0043547	Process	Positive regulation of GTPase activity	IBA	21873635
GO:0043547	Process	Positive regulation of GTPase activity	ISS
GO:0043552	Process	Positive regulation of phosphatidylinositol 3-kinase activity	IDA	15059845, 15778365
GO:0045627	Process	Positive regulation of T-helper 1 cell differentiation	ISS
GO:0045807	Process	Positive regulation of endocytosis	ISS
GO:0045860	Process	Positive regulation of protein kinase activity	IDA	14592837, 15059845
GO:0046330	Process	Positive regulation of JNK cascade	IDA	15778365
GO:0048020	Function	CCR chemokine receptor binding	IBA	21873635
GO:0048020	Function	CCR chemokine receptor binding	IPI	20002784
GO:0048247	Process	Lymphocyte chemotaxis	IBA	21873635
GO:0048260	Process	Positive regulation of receptor-mediated endocytosis	ISS
GO:0048469	Process	Cell maturation	ISS
GO:0050921	Process	Positive regulation of chemotaxis	ISS
GO:0051209	Process	Release of sequestered calcium ion into cytosol	IDA	14592837
GO:0051897	Process	Positive regulation of protein kinase B signaling	IDA	15059845, 15778365
GO:0060491	Process	Regulation of cell projection assembly	ISS
GO:0070098	Process	Chemokine-mediated signaling pathway	IBA	21873635
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IBA	21873635
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	15778365
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	25754930
GO:0071346	Process	Cellular response to interferon-gamma	IBA	21873635
GO:0071347	Process	Cellular response to interleukin-1	IBA	21873635
GO:0071356	Process	Cellular response to tumor necrosis factor	IBA	21873635
GO:0071731	Process	Response to nitric oxide	IDA	16249377
GO:0090023	Process	Positive regulation of neutrophil chemotaxis	IDA	21051556
GO:0097029	Process	Mature conventional dendritic cell differentiation	ISS
GO:0098586	Process	Cellular response to virus	IMP	25754930
GO:1901224	Process	Positive regulation of NIK/NF-kappaB signaling	IDA	15059845
GO:2000147	Process	Positive regulation of cell motility	IDA	15778365
GO:2000549	Process	Positive regulation of dendritic cell dendrite assembly	ISS
GO:2000669	Process	Negative regulation of dendritic cell apoptotic process	IDA	15059845

Other IDs

• MIM: 602227
• HGNC: 10617
• e!Ensembl: ENSG00000172724

Protein

• UniProt ID: Q99731
• Protein name: C-C motif chemokine 19 (Beta-chemokine exodus-3) (CK beta-11) (Epstein-Barr virus-induced molecule 1 ligand chemokine) (EBI1 ligand chemokine) (ELC) (Macrophage inflammatory protein 3 beta) (MIP-3-beta) (Small-inducible cytokine A19)
• Protein function: May play a role not only in inflammatory and immunological responses but also in normal lymphocyte recirculation and homing. May play an important role in trafficking of T-cells in thymus, and T-cell and B-cell migration to secondary lymphoid or
• PDB: 2MP1, 7STA
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00048	IL8	27 → 86	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

• Sequence:

  MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAV
  VFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS

• Sequence length: 98

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway
NF-kappa B signaling pathway

Reactome:

Chemokine receptors bind chemokines
G alpha (i) signalling events
Interleukin-10 signaling

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Dermatitis	Dermatitis, Allergic Contact	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	17597826
Leukemia	Leukemia, Myelocytic, Acute	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297, rs11978267, rs4132601	27903959