CCL18 (C-C motif chemokine ligand 18)

Gene

• Entrez ID: 6362
• Gene name: C-C motif chemokine ligand 18
• Gene symbol: CCL18
• Synonyms: AMAC-1, AMAC1, CKb7, DC-CK1, DCCK1, MIP-4, PARC, SCYA18
• Chromosome: 17
• Chromosome location: 17q12
• Summary: This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT870937	hsa-miR-346	CLIP-seq
MIRT870938	hsa-miR-4251	CLIP-seq
MIRT870939	hsa-miR-4288	CLIP-seq
MIRT870940	hsa-miR-4663	CLIP-seq
MIRT870941	hsa-miR-539	CLIP-seq
MIRT870942	hsa-miR-632	CLIP-seq
MIRT870943	hsa-miR-654-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002548	Process	Monocyte chemotaxis	IBA	21873635
GO:0005515	Function	Protein binding	IPI	21481794
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0006935	Process	Chemotaxis	TAS	9192897
GO:0006954	Process	Inflammatory response	IBA	21873635
GO:0006955	Process	Immune response	TAS	9192897
GO:0007154	Process	Cell communication	TAS	9192897
GO:0007165	Process	Signal transduction	TAS	9233607
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007267	Process	Cell-cell signaling	TAS	9233607
GO:0008009	Function	Chemokine activity	IBA	21873635
GO:0030593	Process	Neutrophil chemotaxis	IBA	21873635
GO:0043547	Process	Positive regulation of GTPase activity	IBA	21873635
GO:0048020	Function	CCR chemokine receptor binding	IBA	21873635
GO:0048247	Process	Lymphocyte chemotaxis	IBA	21873635
GO:0070098	Process	Chemokine-mediated signaling pathway	IBA	21873635
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IBA	21873635
GO:0071346	Process	Cellular response to interferon-gamma	IBA	21873635
GO:0071347	Process	Cellular response to interleukin-1	IBA	21873635
GO:0071356	Process	Cellular response to tumor necrosis factor	IBA	21873635

Other IDs

• MIM: 603757
• HGNC: 10616
• e!Ensembl: ENSG00000275385

Protein

• UniProt ID: P55774
• Protein name: C-C motif chemokine 18 (Alternative macrophage activation-associated CC chemokine 1) (AMAC-1) (CC chemokine PARC) (Dendritic cell chemokine 1) (DC-CK1) (Macrophage inflammatory protein 4) (MIP-4) (Pulmonary and activation-regulated chemokine) (Small-induc
• Protein function: Chemotactic factor that attracts lymphocytes but not monocytes or granulocytes. May be involved in B-cell migration into B-cell follicles in lymph nodes. Attracts naive T-lymphocytes toward dendritic cells and activated macrophages in lymph node
• PDB: 4MHE
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00048	IL8	28 → 85	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

• Sequence:

  MKGLAAALLVLVCTMALCSCAQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVI
  LLTKRGRQICADPNKKWVQKYISDLKLNA

• Sequence length: 89

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Lung cancer	Malignant neoplasm of lung	rs121913530, rs121913529, rs878855122, rs1057519784, rs770315135	23349697

Unknown
Disease name	Disease term	dbSNP ID	References
Lung neoplasms	Lung Neoplasms		23349697