CCL17 (C-C motif chemokine ligand 17)

Gene

• Entrez ID: 6361
• Gene name: C-C motif chemokine ligand 17
• Gene symbol: CCL17
• Synonyms: A-152E5.3, ABCD-2, SCYA17, TARC
• Chromosome: 16
• Chromosome location: 16q21
• Summary: This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019326	hsa-miR-148b-3p	Microarray	17612493
MIRT021928	hsa-miR-128-3p	Microarray	17612493

Transcription factors

Transcription factor	Regulation	Reference
STAT6	Activation	18191727

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002548	Process	Monocyte chemotaxis	IBA	21873635
GO:0005102	Function	Signaling receptor binding	TAS	8702936
GO:0005515	Function	Protein binding	IPI	28381538
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0006935	Process	Chemotaxis	TAS
GO:0006954	Process	Inflammatory response	IBA	21873635
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007267	Process	Cell-cell signaling	TAS	8702936
GO:0007275	Process	Multicellular organism development	TAS	8702936
GO:0008009	Function	Chemokine activity	IBA	21873635
GO:0030593	Process	Neutrophil chemotaxis	IBA	21873635
GO:0031729	Function	CCR4 chemokine receptor binding	IEA
GO:0043547	Process	Positive regulation of GTPase activity	IBA	21873635
GO:0045662	Process	Negative regulation of myoblast differentiation	IEA
GO:0048020	Function	CCR chemokine receptor binding	IBA	21873635
GO:0048247	Process	Lymphocyte chemotaxis	IBA	21873635
GO:0070098	Process	Chemokine-mediated signaling pathway	IBA	21873635
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IBA	21873635
GO:0071346	Process	Cellular response to interferon-gamma	IBA	21873635
GO:0071347	Process	Cellular response to interleukin-1	IBA	21873635
GO:0071356	Process	Cellular response to tumor necrosis factor	IBA	21873635

Other IDs

• MIM: 601520
• HGNC: 10615
• e!Ensembl: ENSG00000102970

Protein

• UniProt ID: Q92583
• Protein name: C-C motif chemokine 17 (CC chemokine TARC) (Small-inducible cytokine A17) (Thymus and activation-regulated chemokine)
• Protein function: Chemokine, which displays chemotactic activity for T lymphocytes, preferentially Th2 cells, but not monocytes or granulocytes. Therefore plays an important role in a wide range of inflammatory and immunological processes (PubMed:8702936, PubMed:
• PDB: 1NR2, 1NR4, 5WK3, 7S4N, 7SCV, 8FJ2, 8SKK
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00048	IL8	31 → 88	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

• Sequence:

  MAPLKMLALVTLLLGASLQHIHAARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRD
  AIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS

• Sequence length: 94

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway
C-type lectin receptor signaling pathway
IL-17 signaling pathway

Reactome:

Chemokine receptors bind chemokines

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Dermatitis	Dermatitis, Atopic	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	18249437

Unknown
Disease name	Disease term	dbSNP ID	References
Eczema	Eczema, Infantile		18249437