CCL11 (C-C motif chemokine ligand 11)

Gene

• Entrez ID: 6356
• Gene name: C-C motif chemokine ligand 11
• Gene symbol: CCL11
• Synonyms: SCYA11
• Chromosome: 17
• Chromosome location: 17q12
• Summary: This antimicrobial gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, displays chemotactic activity for eosinophils, but not mononuclear cells or neutrophils. This eosinophil-specific chemokine is thought to be involved in eosinophilic inflammatory diseases such as atopic dermatitis, allergic rhinitis, asthma and parasitic infections. [provided by RefSeq, Sep 2014]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019315	hsa-miR-148b-3p	Microarray	17612493
MIRT459479	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT459480	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT459481	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT459482	hsa-miR-6077	PAR-CLIP	23592263
MIRT459483	hsa-miR-4784	PAR-CLIP	23592263
MIRT459484	hsa-miR-3150b-3p	PAR-CLIP	23592263
MIRT459485	hsa-miR-6837-5p	PAR-CLIP	23592263
MIRT459486	hsa-miR-7113-5p	PAR-CLIP	23592263
MIRT459487	hsa-miR-4685-5p	PAR-CLIP	23592263
MIRT459488	hsa-miR-6754-5p	PAR-CLIP	23592263
MIRT459489	hsa-miR-4441	PAR-CLIP	23592263
MIRT459490	hsa-miR-4270	PAR-CLIP	23592263
MIRT459491	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT459492	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT459493	hsa-miR-4739	PAR-CLIP	23592263
MIRT459494	hsa-miR-4756-5p	PAR-CLIP	23592263
MIRT459495	hsa-miR-1321	PAR-CLIP	23592263
MIRT459496	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT459497	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT564001	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT564002	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT564003	hsa-miR-1277-5p	PAR-CLIP	20371350

Transcription factors

Transcription factor	Regulation	Reference
NFKB1	Activation	16604092
NFKB1	Unknown	10586089;11076795;14660485
RELA	Activation	16604092
RELA	Unknown	10586089;11076795;14660485
STAT3	Activation	19265112
STAT3	Unknown	20169197
STAT6	Activation	17541284
STAT6	Repression	20169197
STAT6	Unknown	10586089;14660485

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IDA	19525930
GO:0002544	Process	Chronic inflammatory response	IEA
GO:0002548	Process	Monocyte chemotaxis	IBA	21873635
GO:0002551	Process	Mast cell chemotaxis	IEA
GO:0005515	Function	Protein binding	IPI	18275857, 21314817, 23597562, 28381538
GO:0005576	Component	Extracellular region	IDA	20041150
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0006468	Process	Protein phosphorylation	TAS	10706854
GO:0006874	Process	Cellular calcium ion homeostasis	TAS
GO:0006935	Process	Chemotaxis	TAS	10706854
GO:0006954	Process	Inflammatory response	IBA	21873635
GO:0007010	Process	Cytoskeleton organization	IDA	10072545
GO:0007015	Process	Actin filament organization	IEA
GO:0007155	Process	Cell adhesion	TAS	10201960
GO:0007165	Process	Signal transduction	TAS	10706854
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007611	Process	Learning or memory	ISS
GO:0008009	Function	Chemokine activity	IBA	21873635
GO:0008009	Function	Chemokine activity	IDA	10072545
GO:0008360	Process	Regulation of cell shape	IDA	10072545
GO:0009314	Process	Response to radiation	TAS	10708591
GO:0009615	Process	Response to virus	TAS	9558100
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0030335	Process	Positive regulation of cell migration	IDA	19525930
GO:0030593	Process	Neutrophil chemotaxis	IBA	21873635
GO:0030838	Process	Positive regulation of actin filament polymerization	IDA	19525930
GO:0031728	Function	CCR3 chemokine receptor binding	IDA	11425309
GO:0035962	Process	Response to interleukin-13	IEA
GO:0043547	Process	Positive regulation of GTPase activity	IBA	21873635
GO:0043547	Process	Positive regulation of GTPase activity	IDA	19525930
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0046983	Function	Protein dimerization activity	IDA	9712872
GO:0048018	Function	Receptor ligand activity	IDA	11425309
GO:0048020	Function	CCR chemokine receptor binding	IBA	21873635
GO:0048245	Process	Eosinophil chemotaxis	IBA	21873635
GO:0048245	Process	Eosinophil chemotaxis	IDA	10072545
GO:0048247	Process	Lymphocyte chemotaxis	IBA	21873635
GO:0050768	Process	Negative regulation of neurogenesis	ISS
GO:0060444	Process	Branching involved in mammary gland duct morphogenesis	IEA
GO:0060763	Process	Mammary duct terminal end bud growth	IEA
GO:0070098	Process	Chemokine-mediated signaling pathway	IBA	21873635
GO:0070371	Process	ERK1 and ERK2 cascade	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IBA	21873635
GO:0070670	Process	Response to interleukin-4	IEA
GO:0071346	Process	Cellular response to interferon-gamma	IBA	21873635
GO:0071347	Process	Cellular response to interleukin-1	IBA	21873635
GO:0071356	Process	Cellular response to tumor necrosis factor	IBA	21873635
GO:0090647	Process	Modulation of age-related behavioral decline	ISS

Other IDs

• MIM: 601156
• HGNC: 10610
• e!Ensembl: ENSG00000172156

Protein

• UniProt ID: P51671
• Protein name: Eotaxin (C-C motif chemokine 11) (Eosinophil chemotactic protein) (Small-inducible cytokine A11)
• Protein function: In response to the presence of allergens, this protein directly promotes the accumulation of eosinophils, a prominent feature of allergic inflammatory reactions (PubMed:8597956). Binds to CCR3 (PubMed:8631813).
• PDB: 1EOT, 2EOT, 2MPM
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00048	IL8	30 → 88	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

• Sequence:

  MKVSAALLWLLLIAAAFSPQGLAGPASVPTTCCFNLANRKIPLQRLESYRRITSGKCPQK
  AVIFKTKLAKDICADPKKKWVQDSMKYLDQKSPTPKP

• Sequence length: 97

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway
IL-17 signaling pathway
Asthma

Reactome:

Chemokine receptors bind chemokines
Interleukin-4 and Interleukin-13 signaling

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Asthma	Asthma	rs324981, rs121912630, rs150116809, rs4950928, rs708494, rs1581842283
Pulmonary fibrosis	Pulmonary Fibrosis	rs121918666, rs199422300, rs121917737, rs121917834, rs199422294, rs201159197, rs199422297, rs199422305, rs751381953, rs876661305, rs878853260, rs863223336, rs786205702, rs1555811762, rs1060502990, rs1555903332, rs1554038539, rs1554042899, rs938938578	16314464, 17620002
Dermatitis	Dermatitis, Atopic	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	18249437

Unknown
Disease name	Disease term	dbSNP ID	References
Endometriosis	Endometriosis	rs1800629, rs-1, rs1143634	30579999
Alveolitis	Alveolitis, Fibrosing		17620002, 16314464
Cerebral ischemia	Brain Ischemia		15829914
Eczema	Eczema, Infantile		18249437
Endometrioma	Endometrioma		30579999