GediPNet logo

CCL8 (C-C motif chemokine ligand 8)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6355
Gene nameGene Name - the full gene name approved by the HGNC.
C-C motif chemokine ligand 8
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
CCL8
SynonymsGene synonyms aliases
HC14, MCP-2, MCP2, SCYA10, SCYA8
ChromosomeChromosome number
17
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q12
SummarySummary of gene provided in NCBI Entrez Gene.
This antimicrobial gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT050431 hsa-miR-23a-3p CLASH 23622248
MIRT438289 hsa-miR-92a-3p Luciferase reporter assay, Western blot, qRT-PCR 25253336
MIRT438289 hsa-miR-92a-3p Luciferase reporter assay, Western blot, qRT-PCR 25253336
MIRT871120 hsa-miR-1226 CLIP-seq
MIRT871121 hsa-miR-1290 CLIP-seq
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002548 Process Monocyte chemotaxis IBA 21873635
GO:0002687 Process Positive regulation of leukocyte migration IEA
GO:0004672 Function Protein kinase activity IDA 10734056
GO:0005515 Function Protein binding IPI 28381538
GO:0005615 Component Extracellular space IBA 21873635
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID P80075
Protein name C-C motif chemokine 8 (HC14) (Monocyte chemoattractant protein 2) (Monocyte chemotactic protein 2) (MCP-2) (Small-inducible cytokine A8) [Cleaved into: MCP-2(6-76)]
Protein function Chemotactic factor that attracts monocytes, lymphocytes, basophils and eosinophils. May play a role in neoplasia and inflammatory host responses. This protein can bind heparin. The processed form MCP-2(6-76) does not show monocyte chemotactic ac
PDB 1ESR , 7S59 , 7S5A
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00048 IL8
32 90
Small cytokines (intecrine/chemokine), interleukin-8 like
Domain
Sequence
MKVSAALLCLLLMAATFSPQGLAQPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCP
KEAVIFKTKRGKEVCADPKERWVRDSMKHL
DQIFQNLKP
Sequence length 99
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway
 
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Rheumatoid arthritis Rheumatoid Arthritis rs3766379, rs3792876, rs2071592, rs3087456, rs587776843, rs1566328963, rs2240340, rs1557787212 17568789
Unknown
Disease name Disease term dbSNP ID References
Nephrogenic fibrosing dermopathy Nephrogenic Fibrosing Dermopathy 20959327

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412