CCL3 (C-C motif chemokine ligand 3)

Gene

• Entrez ID: 6348
• Gene name: C-C motif chemokine ligand 3
• Gene symbol: CCL3
• Synonyms: G0S19-1, LD78ALPHA, MIP-1-alpha, MIP1A, SCYA3
• Chromosome: 17
• Chromosome location: 17q12
• Summary: This locus represents a small inducible cytokine. The encoded protein, also known as macrophage inflammatory protein 1 alpha, plays a role in inflammatory responses through binding to the receptors CCR1, CCR4 and CCR5. Polymorphisms at this locus may be associated with both resistance and susceptibility to infection by human immunodeficiency virus type 1.[provided by RefSeq, Sep 2010]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT438283	hsa-miR-223-3p	Luciferase reporter assay	24084739
MIRT733713	hsa-miR-24-3p	Microarray, qRT-PCR	28057018

Transcription factors

Transcription factor	Regulation	Reference
E2F1	Unknown	17707233
NFKB1	Activation	16982926
NFKB1	Unknown	11342414;17707233
RELA	Activation	16982926
RELA	Unknown	11342414;17707233
RUNX1	Activation	12771199
STAT1	Activation	16628196

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IEP	12032188
GO:0000165	Process	MAPK cascade	IMP	21147091
GO:0001649	Process	Osteoblast differentiation	IEP	21403648
GO:0001775	Process	Cell activation	IDA	10706735
GO:0002548	Process	Monocyte chemotaxis	IBA	21873635
GO:0002548	Process	Monocyte chemotaxis	IC	10660125
GO:0002548	Process	Monocyte chemotaxis	IDA	10706735
GO:0004672	Function	Protein kinase activity	IDA	10734056
GO:0004698	Function	Calcium-dependent protein kinase C activity	IDA	15764707
GO:0005515	Function	Protein binding	IPI	20959807, 21784977, 26095031, 32296183
GO:0005576	Component	Extracellular region	IDA	20041150
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	20167378, 21403648
GO:0005737	Component	Cytoplasm	IDA	21784977
GO:0005829	Component	Cytosol	IDA	19523456
GO:0006468	Process	Protein phosphorylation	IEA
GO:0006816	Process	Calcium ion transport	IDA	10734056
GO:0006874	Process	Cellular calcium ion homeostasis	IDA	10072545, 10734056, 21403648
GO:0006887	Process	Exocytosis	IDA	10734056
GO:0006935	Process	Chemotaxis	IDA	10679098
GO:0006954	Process	Inflammatory response	IBA	21873635
GO:0006954	Process	Inflammatory response	IDA	10679098, 10706735, 21147091
GO:0007010	Process	Cytoskeleton organization	IDA	10072545
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007267	Process	Cell-cell signaling	IDA	10679098
GO:0008009	Function	Chemokine activity	IBA	21873635
GO:0008009	Function	Chemokine activity	IDA	10072545, 10660125
GO:0008360	Process	Regulation of cell shape	IDA	10072545
GO:0009636	Process	Response to toxic substance	IDA	10841574
GO:0010628	Process	Positive regulation of gene expression	IDA	10706735
GO:0010629	Process	Negative regulation of gene expression	IDA	21403648
GO:0010818	Process	T cell chemotaxis	IDA	10706735
GO:0014808	Process	Release of sequestered calcium ion into cytosol by sarcoplasmic reticulum	IDA	19523456
GO:0016004	Function	Phospholipase activator activity	IDA	10734056
GO:0016301	Function	Kinase activity	IDA	21403648
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0019722	Process	Calcium-mediated signaling	IDA	10072545, 19523456
GO:0023052	Process	Signaling	IEP	12032188
GO:0030335	Process	Positive regulation of cell migration	IDA	7545673, 10706735
GO:0030502	Process	Negative regulation of bone mineralization	IDA	21403648
GO:0030593	Process	Neutrophil chemotaxis	IBA	21873635
GO:0030593	Process	Neutrophil chemotaxis	IDA	10706735
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IDA	21147091
GO:0031726	Function	CCR1 chemokine receptor binding	IPI	7545673, 8699119, 10660125, 15764707
GO:0031730	Function	CCR5 chemokine receptor binding	IPI	8699119, 10679098
GO:0032731	Process	Positive regulation of interleukin-1 beta production	ISS
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS
GO:0042056	Function	Chemoattractant activity	IDA	10072545, 10660125, 10706735, 15001559
GO:0042802	Function	Identical protein binding	IPI	20959807
GO:0043308	Process	Eosinophil degranulation	IDA	10706735
GO:0043491	Process	Protein kinase B signaling	IMP	21147091
GO:0043525	Process	Positive regulation of neuron apoptotic process	ISS
GO:0043547	Process	Positive regulation of GTPase activity	IBA	21873635
GO:0043615	Process	Astrocyte cell migration	ISS
GO:0043922	Process	Negative regulation by host of viral transcription	IDA	10841574
GO:0045671	Process	Negative regulation of osteoclast differentiation	IDA	21403648
GO:0048020	Function	CCR chemokine receptor binding	IBA	21873635
GO:0048245	Process	Eosinophil chemotaxis	IDA	10072545
GO:0048246	Process	Macrophage chemotaxis	ISS
GO:0048247	Process	Lymphocyte chemotaxis	IBA	21873635
GO:0048247	Process	Lymphocyte chemotaxis	IDA	10706735
GO:0050729	Process	Positive regulation of inflammatory response	ISS
GO:0050795	Process	Regulation of behavior	IDA	20167378
GO:0050850	Process	Positive regulation of calcium-mediated signaling	IMP	10679098
GO:0050918	Process	Positive chemotaxis	IEA
GO:0051897	Process	Positive regulation of protein kinase B signaling	IEP	21403648
GO:0051928	Process	Positive regulation of calcium ion transport	IDA	8699119, 15764707
GO:0051930	Process	Regulation of sensory perception of pain	IDA	15764707
GO:0070098	Process	Chemokine-mediated signaling pathway	IBA	21873635
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IBA	21873635
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	21403648
GO:0070723	Process	Response to cholesterol	IDA	19523456
GO:0071346	Process	Cellular response to interferon-gamma	IBA	21873635
GO:0071346	Process	Cellular response to interferon-gamma	IEP	9407497
GO:0071347	Process	Cellular response to interleukin-1	IBA	21873635
GO:0071347	Process	Cellular response to interleukin-1	IEP	9407497
GO:0071356	Process	Cellular response to tumor necrosis factor	IBA	21873635
GO:0071356	Process	Cellular response to tumor necrosis factor	IEP	9407497
GO:0071407	Process	Cellular response to organic cyclic compound	IDA	21147091
GO:0071621	Process	Granulocyte chemotaxis	IDA	10706735
GO:0090280	Process	Positive regulation of calcium ion import	TAS	10925302
GO:1903980	Process	Positive regulation of microglial cell activation	TAS	29518356
GO:1904141	Process	Positive regulation of microglial cell migration	TAS	29518356
GO:2000503	Process	Positive regulation of natural killer cell chemotaxis	IDA	7545673

Other IDs

• MIM: 182283
• HGNC: 10627
• e!Ensembl: ENSG00000277632

Protein

• UniProt ID: P10147
• Protein name: C-C motif chemokine 3 (G0/G1 switch regulatory protein 19-1) (Macrophage inflammatory protein 1-alpha) (MIP-1-alpha) (PAT 464.1) (SIS-beta) (Small-inducible cytokine A3) (Tonsillar lymphocyte LD78 alpha protein) [Cleaved into: MIP-1-alpha(4-69) (LD78-alpha(4-69))]
• Protein function: Monokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV).
• PDB: 1B50, 1B53, 2X69, 2X6G, 3FPU, 3H44, 3KBX, 4RA8, 4ZKB, 5COR, 5D65
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00048	IL8	31 → 88	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

• Sequence:

  MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKP
  GVIFLTKRSRQVCADPSEEWVQKYVSDLELSA

• Sequence length: 92

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway
Toll-like receptor signaling pathway
Chagas disease
Human cytomegalovirus infection
Rheumatoid arthritis
Lipid and atherosclerosis

Reactome:

Chemokine receptors bind chemokines
Interleukin-10 signaling

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Glomerulonephritis	Glomerulonephritis	rs778043831	10385480
Pulmonary fibrosis	Pulmonary Fibrosis	rs121918666, rs199422300, rs121917737, rs121917834, rs199422294, rs201159197, rs199422297, rs199422305, rs751381953, rs876661305, rs878853260, rs863223336, rs786205702, rs1555811762, rs1060502990, rs1555903332, rs1554038539, rs1554042899, rs938938578	17720292, 16324872

Unknown
Disease name	Disease term	dbSNP ID	References
Atherosclerosis	Atherosclerosis	rs699947, rs59439148	24370436
Alveolitis	Alveolitis, Fibrosing		17720292, 16324872
Bright disease	Bright Disease		10385480
Cerebral ischemia	Brain Ischemia		15829914, 17394460
Grand mal status epilepticus	Grand Mal Status Epilepticus		19490431
Liver carcinoma	Liver carcinoma		16284949
Malignant mesothelioma	Malignant mesothelioma		25162674
Myocardial ischemia	Myocardial Ischemia		16214533
Nonconvulsive status epilepticus	Non-Convulsive Status Epilepticus		19490431
Petit mal status	Petit mal status		19490431
Status epilepticus	Status Epilepticus, Complex Partial Status Epilepticus, Status Epilepticus, Subclinical		19490431