GediPNet logo

CCL2 (C-C motif chemokine ligand 2)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6347
Gene nameGene Name - the full gene name approved by the HGNC.
C-C motif chemokine ligand 2
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
CCL2
SynonymsGene synonyms aliases
GDCF-2, HC11, HSMCR30, MCAF, MCP-1, MCP1, SCYA2, SMC-CF
ChromosomeChromosome number
17
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q12
SummarySummary of gene provided in NCBI Entrez Gene.
This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Chemokines are a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the ar
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004284 hsa-miR-124-3p Luciferase reporter assay 19404929
MIRT021047 hsa-miR-155-5p Proteomics 18668040
MIRT024058 hsa-miR-1-3p Microarray 18668037
MIRT030277 hsa-miR-26b-5p Microarray 19088304
MIRT030558 hsa-miR-24-3p Microarray 19748357
Transcription factors
Transcription factor Regulation Reference
APEX1 Activation 17045925
ATF4 Unknown 16931790
CEBPA Activation 24429361
HDAC2 Unknown 22679019
IRF3 Unknown 20483755
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000165 Process MAPK cascade IMP 21147091
GO:0001525 Process Angiogenesis TAS 18334747
GO:0002548 Process Monocyte chemotaxis IBA 21873635
GO:0002548 Process Monocyte chemotaxis IDA 12207323
GO:0004672 Function Protein kinase activity TAS 9973507
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID P13500
Protein name C-C motif chemokine 2 (HC11) (Monocyte chemoattractant protein 1) (Monocyte chemotactic and activating factor) (MCAF) (Monocyte chemotactic protein 1) (MCP-1) (Monocyte secretory protein JE) (Small-inducible cytokine A2)
Protein function Acts as a ligand for C-C chemokine receptor CCR2 (PubMed:10529171, PubMed:10587439, PubMed:9837883). Signals through binding and activation of CCR2 and induces a strong chemotactic response and mobilization of intracellular calcium ions (PubMed:
PDB 1DOK , 1DOL , 1DOM , 1DON , 1ML0 , 2BDN , 2NZ1 , 3IFD , 4DN4 , 4R8I , 4ZK9 , 7SO0 , 7XA3 , 8FJ0
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00048 IL8
32 90
Small cytokines (intecrine/chemokine), interleukin-8 like
Domain
Sequence
MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCP
KEAVIFKTIVAKEICADPKQKWVQDSMDHL
DKQTQTPKT
Sequence length 99
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway
NOD-like receptor signaling pathway
IL-17 signaling pathway
TNF signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Yersinia infection
Chagas disease
Malaria
Human cytomegalovirus infection
Influenza A
Herpes simplex virus 1 infection
Coronavirus disease - COVID-19
Rheumatoid arthritis
Lipid and atherosclerosis
Fluid shear stress and atherosclerosis
  Chemokine receptors bind chemokines
ATF4 activates genes in response to endoplasmic reticulum stress
Interleukin-10 signaling
Interleukin-4 and Interleukin-13 signaling
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Anencephaly Anencephaly, Exencephaly, Iniencephaly rs773607884
Asthma Asthma rs324981, rs121912630, rs150116809, rs4950928, rs708494, rs1581842283 19373627
Becker muscular dystrophy Becker Muscular Dystrophy rs104894787, rs1569564916, rs1569546198, rs128626236, rs128626237, rs1556834513, rs2147483647, rs267606771, rs5030730, rs587776747, rs398122853, rs398123935, rs398123954, rs398123985, rs398124002, rs398124034, rs398124082, rs398124099, rs398124105, rs373286166, rs727503864, rs796065325, rs794726993, rs794727666, rs863225001, rs779739455, rs886042106, rs886042840, rs763936813, rs886044406, rs1060502639, rs1064796764, rs753662330, rs398123909, rs182575709, rs1556880354, rs1557380616, rs1557047827, rs796523999, rs886043375, rs1556875224, rs1556852444, rs1569558953, rs1569560475, rs1569563740, rs1602169535, rs1601809011, rs1603632322, rs1603636537, rs376745644 21641384
Carcinoma Squamous cell carcinoma rs121912654, rs555607708, rs786202962, rs1564055259 25199511
Unknown
Disease name Disease term dbSNP ID References
Acrania Acrania
Alveolitis Alveolitis, Fibrosing 17720292, 26163174, 16324872
Atherosclerosis Atherosclerosis rs699947, rs59439148 12928151, 12677255, 20720404
Cerebral infraction Infarction, Middle Cerebral Artery 12374626, 25257527, 23043544

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412