SCT (secretin)

Gene

• Entrez ID: 6343
• Gene name: Secretin
• Gene symbol: SCT
• Synonyms: -
• Chromosome: 11
• Chromosome location: 11p15.5
• Summary: This gene encodes a member of the glucagon family of peptides. The encoded preproprotein is secreted by endocrine S cells in the proximal small intestinal mucosa as a prohormone, then proteolytically processed to generate the mature peptide hormone. The r

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1330948	hsa-miR-361-3p	CLIP-seq
MIRT1330949	hsa-miR-4722-3p	CLIP-seq
MIRT1330950	hsa-miR-4793-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
SP1	Unknown	15118068
SP3	Unknown	15118068

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001664	Function	G protein-coupled receptor binding	IPI	7612008
GO:0002024	Process	Diet induced thermogenesis	ISS
GO:0005102	Function	Signaling receptor binding	IBA	21873635
GO:0005179	Function	Hormone activity	ISS
GO:0005179	Function	Hormone activity	NAS	11060443
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005575	Component	Cellular_component	ND
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	ISS
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007420	Process	Brain development	IBA	21873635
GO:0009992	Process	Cellular water homeostasis	ISS
GO:0021766	Process	Hippocampus development	ISS
GO:0030157	Process	Pancreatic juice secretion	NAS	11060443
GO:0031667	Process	Response to nutrient levels	ISS
GO:0032098	Process	Regulation of appetite	ISS
GO:0043950	Process	Positive regulation of cAMP-mediated signaling	IEA
GO:0046659	Function	Digestive hormone activity	ISS
GO:0047485	Function	Protein N-terminus binding	IEA
GO:0048167	Process	Regulation of synaptic plasticity	ISS
GO:0048566	Process	Embryonic digestive tract development	IEA
GO:0050996	Process	Positive regulation of lipid catabolic process	ISS
GO:0090187	Process	Positive regulation of pancreatic juice secretion	IBA	21873635
GO:0090274	Process	Positive regulation of somatostatin secretion	IBA	21873635
GO:1903640	Process	Negative regulation of gastrin-induced gastric acid secretion	IBA	21873635

Other IDs

• MIM: 182099
• HGNC: 10607
• e!Ensembl: ENSG00000070031

Protein

• UniProt ID: P09683
• Protein name: Secretin
• Protein function: Hormone involved in different processes, such as regulation of the pH of the duodenal content, food intake and water homeostasis (PubMed:25332973). Exerts its biological effects by binding to secretin receptor (SCTR), a G-protein coupled recepto
• PDB: 6WI9, 6WZG, 7D3S
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00123	Hormone_2	28 → 55	Peptide hormone	Family

• Sequence:

  MAPRPLLLLLLLLGGSAARPAPPRARRHSDGTFTSELSRLREGARLQRLLQGLVGKRSEQ
  DAENSMAWTRLSAGLLCPSGSNMPILQAWMPLDGTWSPWLPPGPMVSEPAGAAAEGTLRP
  R

• Sequence length: 121

Pathways

KEGG:

Neuroactive ligand-receptor interaction
Pancreatic secretion
Bile secretion

Reactome:

G alpha (s) signalling events
Glucagon-type ligand receptors
ADORA2B mediated anti-inflammatory cytokines production

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Autism	Autistic Disorder	rs121964908, rs121912597, rs2710102, rs7794745, rs142990298, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699, rs1553510219, rs1684182454, rs1559060428, rs1553510677, rs1576352885, rs1574152522, rs1574152672, rs1696658542, rs1751123722, rs1750373491, rs1751075634	12732234, 15272612, 16168596, 15206007

Unknown
Disease name	Disease term	dbSNP ID	References
Choledochal cyst	Choledochal Cyst, Choledochal Cyst, Type I, Choledochal Cyst, Type II, Choledochal Cyst, Type III, Choledochal Cyst, Type IV, Choledochal Cyst, Type V		18988797
Sclerocystic ovaries	Sclerocystic Ovaries		21411543
Polycystic ovary syndrome	Polycystic Ovary Syndrome		21411543