CEACAM1 (CEA cell adhesion molecule 1)

Gene

• Entrez ID: 634
• Gene name: CEA cell adhesion molecule 1
• Gene symbol: CEACAM1
• Synonyms: BGP, BGP1, BGPI
• Chromosome: 19
• Chromosome location: 19q13.2
• Summary: This gene encodes a member of the carcinoembryonic antigen (CEA) gene family, which belongs to the immunoglobulin superfamily. Two subgroups of the CEA family, the CEA cell adhesion molecules and the pregnancy-specific glycoproteins, are located within a

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT882915	hsa-miR-1343	CLIP-seq
MIRT882916	hsa-miR-3074-5p	CLIP-seq
MIRT882917	hsa-miR-520d-5p	CLIP-seq
MIRT882918	hsa-miR-524-5p	CLIP-seq
MIRT882919	hsa-miR-935	CLIP-seq
MIRT2198338	hsa-miR-1270	CLIP-seq
MIRT2198339	hsa-miR-620	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
HNF4A	Activation	8055923
IRF1	Activation	21050451
NFKB1	Activation	11306560
RELA	Activation	11306560
SOX9	Unknown	22209504
SP2	Repression	15126343
USF1	Activation	21050451;8055923
USF2	Activation	8055923

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	NAS	15687237
GO:0001558	Process	Regulation of cell growth	ISS
GO:0001568	Process	Blood vessel development	ISS
GO:0001915	Process	Negative regulation of T cell mediated cytotoxicity	IDA	18424730
GO:0002859	Process	Negative regulation of natural killer cell mediated cytotoxicity directed against tumor cell target	IMP	23696226
GO:0003674	Function	Molecular_function	ND
GO:0003779	Function	Actin binding	IPI	17192268
GO:0005515	Function	Protein binding	IPI	11035932, 11994468, 16246332, 16282604, 18424730, 18497748, 21982860, 23696226, 25363763
GO:0005516	Function	Calmodulin binding	ISS
GO:0005886	Component	Plasma membrane	IDA	17192268
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	NAS	15687237
GO:0005911	Component	Cell-cell junction	IDA	16291724
GO:0005912	Component	Adherens junction	ISS
GO:0006469	Process	Negative regulation of protein kinase activity	ISS
GO:0007155	Process	Cell adhesion	ISS
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	ISS
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	NAS	15687237
GO:0007229	Process	Integrin-mediated signaling pathway	NAS	15687237
GO:0009925	Component	Basal plasma membrane	ISS
GO:0009986	Component	Cell surface	IDA	25363763
GO:0009986	Component	Cell surface	ISS
GO:0010594	Process	Regulation of endothelial cell migration	ISS
GO:0014066	Process	Regulation of phosphatidylinositol 3-kinase signaling	ISS
GO:0015125	Function	Bile acid transmembrane transporter activity	ISS
GO:0015721	Process	Bile acid and bile salt transport	ISS
GO:0016020	Component	Membrane	TAS	2457922
GO:0016021	Component	Integral component of membrane	IDA	11994468
GO:0016324	Component	Apical plasma membrane	IDA	10436421
GO:0016324	Component	Apical plasma membrane	ISS
GO:0016328	Component	Lateral plasma membrane	ISS
GO:0016477	Process	Cell migration	NAS	15687237
GO:0019900	Function	Kinase binding	IPI	7478590
GO:0019903	Function	Protein phosphatase binding	IPI	18424730
GO:0030054	Component	Cell junction	IDA	8018919
GO:0030054	Component	Cell junction	ISS
GO:0030334	Process	Regulation of cell migration	IDA	16291724
GO:0030658	Component	Transport vesicle membrane	IEA
GO:0030853	Process	Negative regulation of granulocyte differentiation	ISS
GO:0031005	Function	Filamin binding	IPI	16291724
GO:0031528	Component	Microvillus membrane	IEA
GO:0032692	Process	Negative regulation of interleukin-1 production	ISS
GO:0032869	Process	Cellular response to insulin stimulus	ISS
GO:0035579	Component	Specific granule membrane	TAS
GO:0035726	Process	Common myeloid progenitor cell proliferation	ISS
GO:0038016	Process	Insulin receptor internalization	ISS
GO:0038158	Process	Granulocyte colony-stimulating factor signaling pathway	ISS
GO:0042058	Process	Regulation of epidermal growth factor receptor signaling pathway	ISS
GO:0042101	Component	T cell receptor complex	IDA	18424730
GO:0042802	Function	Identical protein binding	IDA	26483485
GO:0042802	Function	Identical protein binding	IPI	19948502
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0043116	Process	Negative regulation of vascular permeability	ISS
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0043318	Process	Negative regulation of cytotoxic T cell degranulation	IDA	18424730
GO:0044319	Process	Wound healing, spreading of cells	IDA	16291724
GO:0045601	Process	Regulation of endothelial cell differentiation	ISS
GO:0045717	Process	Negative regulation of fatty acid biosynthetic process	ISS
GO:0046983	Function	Protein dimerization activity	ISS
GO:0050860	Process	Negative regulation of T cell receptor signaling pathway	IDA	18424730
GO:0050900	Process	Leukocyte migration	TAS
GO:0051055	Process	Negative regulation of lipid biosynthetic process	ISS
GO:0060312	Process	Regulation of blood vessel remodeling	ISS
GO:0070062	Component	Extracellular exosome	HDA	19199708, 23533145
GO:0070372	Process	Regulation of ERK1 and ERK2 cascade	ISS
GO:0070821	Component	Tertiary granule membrane	TAS
GO:0090331	Process	Negative regulation of platelet aggregation	ISS
GO:0098742	Process	Cell-cell adhesion via plasma-membrane adhesion molecules	ISS
GO:1901143	Process	Insulin catabolic process	ISS
GO:1903385	Process	Regulation of homophilic cell adhesion	ISS
GO:1903670	Process	Regulation of sprouting angiogenesis	ISS
GO:1990782	Function	Protein tyrosine kinase binding	IPI	18424730
GO:2000346	Process	Negative regulation of hepatocyte proliferation	ISS
GO:2001214	Process	Positive regulation of vasculogenesis	ISS

Other IDs

• MIM: 109770
• HGNC: 1814
• e!Ensembl: ENSG00000079385

Protein

• UniProt ID: P13688
• Protein name: Cell adhesion molecule CEACAM1 (Biliary glycoprotein 1) (BGP-1) (Carcinoembryonic antigen-related cell adhesion molecule 1) (CEA cell adhesion molecule 1) (CD antigen CD66a)
• Protein function: [Isoform 1]: Cell adhesion protein that mediates homophilic cell adhesion in a calcium-independent manner (By similarity). Plays a role as coinhibitory receptor in immune response, insulin action and also functions as an activator during angioge
• PDB: 2GK2, 4QXW, 4WHD, 5DZL, 6AW2, 6GBG, 6GBH, 6V3P, 6XNO, 6XNT, 6XNW, 6XO1, 7MU8, 7RPP, 8CXJ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07686	V-set	38 → 141	Immunoglobulin V-set domain	Domain
  PF13927	Ig_3	146 → 219		Domain
  PF13895	Ig_2	239 → 318	Immunoglobulin domain	Domain
  PF00047	ig	331 → 411	Immunoglobulin domain	Domain

• Sequence:

  MGHLSAPLHRVRVPWQGLLLTASLLTFWNPPTTAQLTTESMPFNVAEGKEVLLLVHNLPQ
  QLFGYSWYKGERVDGNRQIVGYAIGTQQATPGPANSGRETIYPNASLLIQNVTQNDTGFY
  TLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPETQDTTYLWWI
  NNQSLPVSPRLQLSNGNRTLTLLSVTRNDTGPYECEIQNPVSANRSDPVTLNVTYGPDTP
  TISPSDTYYRPGANLSLSCYAASNPPAQYSWLINGTFQQSTQELFIPNITVNNSGSYTCH
  ANNSVTGCNRTTVKTIIVTELSPVVAKPQIKASKTTVTGDKDSVNLTCSTNDTGISIRWF
  FKNQSLPSSERMKLSQGNTTLSINPVKREDAGTYWCEVFNPISKNQSDPIMLNVNYNALP
  QENGLSPGAIAGIVIGVVALVALIAVALACFLHFGKTGRASDQRDLTEHKPSVSNHTQDH
  SNDPPNKMNEVTYSTLNFEAQQPTQPTSASPSLTATEIIYSEVKKQ

• Sequence length: 526

Pathways

Reactome:

Fibronectin matrix formation
Cell surface interactions at the vascular wall
Neutrophil degranulation

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Adenocarcinoma	Adenocarcinoma, Adenocarcinoma, Basal Cell, Adenocarcinoma, Oxyphilic, Adenocarcinoma, Tubular	rs121913530, rs886039394, rs121913474	21552421
Carcinoma	Carcinoma, Cribriform, Carcinoma, Granular Cell	rs121912654, rs555607708, rs786202962, rs1564055259	21552421
Lung cancer	Malignant neoplasm of lung	rs121913530, rs121913529, rs878855122, rs1057519784, rs770315135	21552421

Unknown
Disease name	Disease term	dbSNP ID	References
Lung neoplasms	Lung Neoplasms		21552421
Miscarriage	Miscarriage		18539642