BGLAP (bone gamma-carboxyglutamate protein)

Gene

• Entrez ID: 632
• Gene name: Bone gamma-carboxyglutamate protein
• Gene symbol: BGLAP
• Synonyms: BGP, OC, OCN
• Chromosome: 1
• Chromosome location: 1q22
• Summary: This gene encodes a highly abundant bone protein secreted by osteoblasts that regulates bone remodeling and energy metabolism. The encoded protein contains a Gla (gamma carboxyglutamate) domain, which functions in binding to calcium and hydroxyapatite, th

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003596	hsa-miR-135b-5p	qRT-PCR	19795981
MIRT021227	hsa-miR-146a-5p	qRT-PCR	20110513
MIRT026111	hsa-miR-192-5p	Microarray	19074876
MIRT028806	hsa-miR-26b-5p	Microarray	19088304
MIRT032219	hsa-let-7b-5p	Proteomics	18668040
MIRT821158	hsa-miR-1254	CLIP-seq
MIRT821159	hsa-miR-185	CLIP-seq
MIRT821160	hsa-miR-3116	CLIP-seq
MIRT821161	hsa-miR-3154	CLIP-seq
MIRT821162	hsa-miR-4254	CLIP-seq
MIRT821163	hsa-miR-4306	CLIP-seq
MIRT821164	hsa-miR-4644	CLIP-seq
MIRT821165	hsa-miR-550a	CLIP-seq
MIRT821166	hsa-miR-661	CLIP-seq
MIRT1942725	hsa-miR-3125	CLIP-seq
MIRT1942726	hsa-miR-3916	CLIP-seq
MIRT1942727	hsa-miR-4271	CLIP-seq
MIRT1942728	hsa-miR-4725-3p	CLIP-seq
MIRT2444777	hsa-miR-3127-5p	CLIP-seq
MIRT2444778	hsa-miR-3158-3p	CLIP-seq
MIRT2444779	hsa-miR-3192	CLIP-seq
MIRT2444780	hsa-miR-3689a-3p	CLIP-seq
MIRT2444781	hsa-miR-3689c	CLIP-seq
MIRT2444782	hsa-miR-3918	CLIP-seq
MIRT2444783	hsa-miR-4446-3p	CLIP-seq
MIRT2444784	hsa-miR-4492	CLIP-seq
MIRT2444785	hsa-miR-4498	CLIP-seq
MIRT2444786	hsa-miR-4505	CLIP-seq
MIRT2444787	hsa-miR-4728-5p	CLIP-seq
MIRT2444788	hsa-miR-762	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ATF4	Unknown	21866569
ATF6	Unknown	22102412
GTF2F1	Unknown	9265625
MSX2	Repression	10569470
NR3C1	Repression	9303434
RARG	Activation	9113387
SMAD3	Unknown	11278818
SMAD4	Unknown	11278818
TP53	Activation	21964930
VDR	Unknown	20227497

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001501	Process	Skeletal system development	TAS	10865224
GO:0001649	Process	Osteoblast differentiation	IBA	21873635
GO:0001649	Process	Osteoblast differentiation	IEP	17023519
GO:0002076	Process	Osteoblast development	IEA
GO:0005198	Function	Structural molecule activity	NAS	10486212
GO:0005509	Function	Calcium ion binding	IBA	21873635
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IBA	21873635
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IDA	11856645
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005791	Component	Rough endoplasmic reticulum	IEA
GO:0005796	Component	Golgi lumen	TAS
GO:0006888	Process	Endoplasmic reticulum to Golgi vesicle-mediated transport	TAS
GO:0007155	Process	Cell adhesion	NAS	12202187
GO:0007569	Process	Cell aging	IEA
GO:0008147	Function	Structural constituent of bone	IBA	21873635
GO:0008147	Function	Structural constituent of bone	NAS	12467198
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0009629	Process	Response to gravity	IEA
GO:0010043	Process	Response to zinc ion	IEA
GO:0014823	Process	Response to activity	IEA
GO:0030282	Process	Bone mineralization	NAS	10486212
GO:0030425	Component	Dendrite	IEA
GO:0030500	Process	Regulation of bone mineralization	IEA
GO:0031982	Component	Vesicle	IEA
GO:0032571	Process	Response to vitamin K	IEA
GO:0033280	Process	Response to vitamin D	IEP	17023519
GO:0033574	Process	Response to testosterone	IEA
GO:0033594	Process	Response to hydroxyisoflavone	IEA
GO:0042476	Process	Odontogenesis	IEA
GO:0042493	Process	Response to drug	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0043627	Process	Response to estrogen	IEA
GO:0045124	Process	Regulation of bone resorption	NAS	10486212
GO:0045471	Process	Response to ethanol	IEA
GO:0045670	Process	Regulation of osteoclast differentiation	NAS	10486212
GO:0046848	Function	Hydroxyapatite binding	IBA	21873635
GO:0046848	Function	Hydroxyapatite binding	NAS	10486212
GO:0051384	Process	Response to glucocorticoid	IEA
GO:0060348	Process	Bone development	IBA	21873635
GO:0071305	Process	Cellular response to vitamin D	IEA
GO:0071363	Process	Cellular response to growth factor stimulus	IEA
GO:1900076	Process	Regulation of cellular response to insulin stimulus	IEA

Other IDs

• MIM: 112260
• HGNC: 1043
• e!Ensembl: ENSG00000242252

Protein

• UniProt ID: P02818
• Protein name: Osteocalcin (Bone Gla protein) (BGP) (Gamma-carboxyglutamic acid-containing protein)
• Protein function: Bone protein that constitutes 1-2% of the total bone protein, and which acts as a negative regulator of bone formation (PubMed:3019668, PubMed:6967872). Functions to limit bone formation without impairing bone resorption or mineralization (By si
• PDB: 8XS1, 9BUR, 9BUX
• Sequence:

  MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAP
  VPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV

• Sequence length: 100

Pathways

KEGG:

Parathyroid hormone synthesis, secretion and action

Reactome:

Gamma-carboxylation of protein precursors
Transport of gamma-carboxylated protein precursors from the endoplasmic reticulum to the Golgi apparatus
Removal of aminoterminal propeptides from gamma-carboxylated proteins

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Asthma	Asthma	rs324981, rs121912630, rs150116809, rs4950928, rs708494, rs1581842283	8429434
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	14666681
Tumoral calcinosis	Tumoral calcinosis	rs104894343, rs104894344, rs745655924, rs137853086, rs375879489, rs761396172, rs137853087, rs137853091, rs137853088, rs137853089, rs137853090, rs766750282, rs760830864, rs786205250, rs267606841, rs1555096583, rs1220533001, rs762936774, rs775341386	21335463

Unknown
Disease name	Disease term	dbSNP ID	References
Cardiac valvular disease	Heart valve disease		21335463
Prostatic neoplasms	Prostatic Neoplasms		14666681