SERPINB4 (serpin family B member 4)

Gene

• Entrez ID: 6318
• Gene name: Serpin family B member 4
• Gene symbol: SERPINB4
• Synonyms: LEUPIN, PI11, SCCA-2, SCCA1, SCCA2
• Chromosome: 18
• Chromosome location: 18q21.33
• Summary: The protein encoded by this gene is a member of the serpin family of serine protease inhibitors. The encoded protein is highly expressed in many tumor cells and can inactivate granzyme M, an enzyme that kills tumor cells. This protein, along with serpin B

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT443446	hsa-miR-4517	PAR-CLIP	22100165
MIRT443445	hsa-miR-3123	PAR-CLIP	22100165
MIRT443444	hsa-miR-556-5p	PAR-CLIP	22100165
MIRT443443	hsa-miR-6807-5p	PAR-CLIP	22100165
MIRT443446	hsa-miR-4517	PAR-CLIP	22100165
MIRT443445	hsa-miR-3123	PAR-CLIP	22100165
MIRT443444	hsa-miR-556-5p	PAR-CLIP	22100165
MIRT443443	hsa-miR-6807-5p	PAR-CLIP	22100165
MIRT2100127	hsa-miR-4263	CLIP-seq
MIRT2100128	hsa-miR-4719	CLIP-seq
MIRT2100129	hsa-miR-4799-5p	CLIP-seq
MIRT2100130	hsa-miR-576-5p	CLIP-seq
MIRT2325020	hsa-miR-4282	CLIP-seq
MIRT2100128	hsa-miR-4719	CLIP-seq
MIRT2620601	hsa-miR-3671	CLIP-seq
MIRT2620602	hsa-miR-607	CLIP-seq
MIRT2620601	hsa-miR-3671	CLIP-seq
MIRT2620602	hsa-miR-607	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002020	Function	Protease binding	IPI	21857942
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IBA	21873635
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IDA	21857942
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	NAS	7589435
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005737	Component	Cytoplasm	IEA
GO:0010466	Process	Negative regulation of peptidase activity	IDA	12949073
GO:0010951	Process	Negative regulation of endopeptidase activity	IBA	21873635
GO:0019899	Function	Enzyme binding	IPI	23382074
GO:0030162	Process	Regulation of proteolysis	NAS	7589435
GO:0042270	Process	Protection from natural killer cell mediated cytotoxicity	IMP	21857942

Other IDs

• MIM: 600518
• HGNC: 10570
• e!Ensembl: ENSG00000206073

Protein

• UniProt ID: P48594
• Protein name: Serpin B4 (Leupin) (Peptidase inhibitor 11) (PI-11) (Squamous cell carcinoma antigen 2) (SCCA-2)
• Protein function: May act as a protease inhibitor to modulate the host immune response against tumor cells.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00079	Serpin	6 → 390	Serpin (serine protease inhibitor)	Domain

• Sequence:

  MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQISKVLHFD
  QVTENTTEKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYQFLQEYL
  DAIKKFYQTSVESTDFANAPEESRKKINSWVESQTNEKIKNLFPDGTIGNDTTLVLVNAI
  YFKGQWENKFKKENTKEEKFWPNKNTYKSVQMMRQYNSFNFALLEDVQAKVLEIPYKGKD
  LSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETCVDLHLPRFKMEESYDLKDTLR
  TMGMVNIFNGDADLSGMTWSHGLSVSKVLHKAFVEVTEEGVEAAAATAVVVVELSSPSTN
  EEFCCNHPFLFFIRQNKTNSILFYGRFSSP

• Sequence length: 390

Pathways

KEGG:

Amoebiasis

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Dermatitis	Contact Dermatitis	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	25724174

Unknown
Disease name	Disease term	dbSNP ID	References
Miscarriage	Miscarriage		18539642