SERPINB3 (serpin family B member 3)

Gene

• Entrez ID: 6317
• Gene name: Serpin family B member 3
• Gene symbol: SERPINB3
• Synonyms: HsT1196, SCC, SCCA-1, SCCA-PD, SCCA1, SSCA1, T4-A
• Chromosome: 18
• Chromosome location: 18q21.33

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT443662	hsa-miR-4517	PAR-CLIP	22100165
MIRT443661	hsa-miR-3123	PAR-CLIP	22100165
MIRT443660	hsa-miR-556-5p	PAR-CLIP	22100165
MIRT443659	hsa-miR-6807-5p	PAR-CLIP	22100165
MIRT443662	hsa-miR-4517	PAR-CLIP	22100165
MIRT443661	hsa-miR-3123	PAR-CLIP	22100165
MIRT443660	hsa-miR-556-5p	PAR-CLIP	22100165
MIRT443659	hsa-miR-6807-5p	PAR-CLIP	22100165
MIRT2100126	hsa-miR-4719	CLIP-seq
MIRT2325019	hsa-miR-4282	CLIP-seq
MIRT2100126	hsa-miR-4719	CLIP-seq
MIRT2620599	hsa-miR-3671	CLIP-seq
MIRT2620600	hsa-miR-607	CLIP-seq
MIRT2620599	hsa-miR-3671	CLIP-seq
MIRT2620600	hsa-miR-607	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001618	Function	Virus receptor activity	IDA	12975381
GO:0002020	Function	Protease binding	IPI	21383048
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IBA	21873635
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	NAS	7724531
GO:0004869	Function	Cysteine-type endopeptidase inhibitor activity	IMP	21383048
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IDA	20527027, 21383048
GO:0005737	Component	Cytoplasm	IDA	20527027
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	20527027
GO:0010466	Process	Negative regulation of peptidase activity	IDA	12949073
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IMP	20527027
GO:0010950	Process	Positive regulation of endopeptidase activity	IDA	20527027
GO:0010951	Process	Negative regulation of endopeptidase activity	IBA	21873635
GO:0010951	Process	Negative regulation of endopeptidase activity	IMP	21383048
GO:0030335	Process	Positive regulation of cell migration	IMP	20527027
GO:0031410	Component	Cytoplasmic vesicle	IDA	21383048
GO:0031982	Component	Vesicle	HDA	19190083
GO:0035425	Process	Autocrine signaling	IMP	20527027
GO:0035578	Component	Azurophil granule lumen	TAS
GO:0038001	Process	Paracrine signaling	IMP	20527027
GO:0043086	Process	Negative regulation of catalytic activity	IDA	10956412
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0043508	Process	Negative regulation of JUN kinase activity	IMP	21383048
GO:0045861	Process	Negative regulation of proteolysis	IDA	12975381
GO:0046718	Process	Viral entry into host cell	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867

Other IDs

• MIM: 600517
• HGNC: 10569
• e!Ensembl: ENSG00000057149

Protein

• UniProt ID: P29508
• Protein name: Serpin B3 (Protein T4-A) (Squamous cell carcinoma antigen 1) (SCCA-1)
• Protein function: May act as a papain-like cysteine protease inhibitor to modulate the host immune response against tumor cells. Also functions as an inhibitor of UV-induced apoptosis via suppression of the activity of c-Jun NH(2)-terminal kinase (JNK1). {ECO:000
• PDB: 2ZV6, 4ZK0, 4ZK3
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00079	Serpin	6 → 390	Serpin (serine protease inhibitor)	Domain

• Sequence:

  MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFD
  QVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYL
  DAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAI
  YFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKD
  LSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLR
  TMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTN
  EEFHCNHPFLFFIRQNKTNSILFYGRFSSP

• Sequence length: 390

Pathways

KEGG:

Amoebiasis

Reactome:

Neutrophil degranulation

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Carcinoma	Squamous cell carcinoma	rs121912654, rs555607708, rs786202962, rs1564055259	15274141
Dermatitis	Contact Dermatitis	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	25724174
Esophagus neoplasm	Esophageal Neoplasms, Squamous cell carcinoma of esophagus, Malignant neoplasm of esophagus	rs28934578, rs121918714, rs1567556006, rs1575166666	15986332, 21517111

Unknown
Disease name	Disease term	dbSNP ID	References
Miscarriage	Miscarriage		18539642
Mouth neoplasms	Mouth Neoplasms		15274141
Malignant neoplasm of mouth	Malignant neoplasm of mouth		15274141