S100B (S100 calcium binding protein B)

Gene

• Entrez ID: 6285
• Gene name: S100 calcium binding protein B
• Gene symbol: S100B
• Synonyms: NEF, S100, S100-B, S100beta
• Chromosome: 21
• Chromosome location: 21q22.3
• Summary: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003735	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Northern blot	19102781
MIRT003736	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR, Northern blot	19102781
MIRT731708	hsa-miR-296-5p	Luciferase reporter assay	27186401
MIRT731708	hsa-miR-296-5p	Luciferase reporter assay, qRT-PCR, Western blot	27186401
MIRT1324165	hsa-miR-1182	CLIP-seq
MIRT1324166	hsa-miR-1908	CLIP-seq
MIRT1324167	hsa-miR-3618	CLIP-seq
MIRT1324168	hsa-miR-602	CLIP-seq
MIRT1324169	hsa-miR-663	CLIP-seq
MIRT1324170	hsa-miR-887	CLIP-seq
MIRT2320440	hsa-miR-1305	CLIP-seq
MIRT2320441	hsa-miR-3133	CLIP-seq
MIRT2320442	hsa-miR-3671	CLIP-seq
MIRT2320443	hsa-miR-4519	CLIP-seq
MIRT2320444	hsa-miR-4773	CLIP-seq
MIRT2320445	hsa-miR-607	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
HOXC11	Unknown	20145129
TP53	Activation	15178678

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001726	Component	Ruffle	IDA	10913138
GO:0005509	Function	Calcium ion binding	IBA	21873635
GO:0005509	Function	Calcium ion binding	NAS	9519411
GO:0005515	Function	Protein binding	IPI	3111527, 10913138, 16189514, 17660747, 17726019, 20591429, 21516116, 25416956, 26496610, 26871637, 27107012, 29997244, 31515488, 31837246, 32296183, 32814053
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	10913138
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	10913138
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	IDA
GO:0007409	Process	Axonogenesis	TAS	8202493
GO:0007417	Process	Central nervous system development	TAS	8202493
GO:0007611	Process	Learning or memory	ISS
GO:0008270	Function	Zinc ion binding	ISS
GO:0008284	Process	Positive regulation of cell population proliferation	IBA	21873635
GO:0042802	Function	Identical protein binding	IPI	9519411, 10913138, 17660747, 25416956, 26871637, 27107012, 32296183
GO:0042803	Function	Protein homodimerization activity	IDA	10913138
GO:0042803	Function	Protein homodimerization activity	IPI	9519411
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IBA	21873635
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	15033494
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA
GO:0044548	Function	S100 protein binding	IBA	21873635
GO:0044548	Function	S100 protein binding	IPI	9519411, 10913138
GO:0045087	Process	Innate immune response	TAS
GO:0048156	Function	Tau protein binding	ISS
GO:0048306	Function	Calcium-dependent protein binding	IBA	21873635
GO:0048306	Function	Calcium-dependent protein binding	IDA	10913138
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	12118070, 15033494
GO:0050786	Function	RAGE receptor binding	IBA	21873635
GO:0050786	Function	RAGE receptor binding	IPI	15033494

Other IDs

• MIM: 176990
• HGNC: 10500
• e!Ensembl: ENSG00000160307

Protein

• UniProt ID: P04271
• Protein name: Protein S100-B (S-100 protein beta chain) (S-100 protein subunit beta) (S100 calcium-binding protein B)
• Protein function: Small zinc- and- and calcium-binding protein that is highly expressed in astrocytes and constitutes one of the most abundant soluble proteins in brain (PubMed:20950652, PubMed:6487634). Weakly binds calcium but binds zinc very tightly-distinct b
• PDB: 1MQ1, 1UWO, 2H61, 2M49, 2PRU, 3CZT, 3D0Y, 3D10, 3HCM, 4XYN, 5CSF, 5CSI, 5CSJ, 5CSN, 5D7F
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01023	S_100	4 → 46	S-100/ICaBP type calcium binding domain	Domain
  PF00036	EF-hand_1	53 → 81	EF hand	Domain

• Sequence:

  MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMET
  LDNDGDGECDFQEFMAFVAMVTTACHEFFEHE

• Sequence length: 92

Pathways

Reactome:

Nuclear signaling by ERBB4
TAK1 activates NFkB by phosphorylation and activation of IKKs complex
Advanced glycosylation endproduct receptor signaling
TRAF6 mediated NF-kB activation

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Myocardial infarction	Myocardial Infarction	rs12316150, rs41303970, rs909253, rs7291467, rs2234693	9788975
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	20398908, 22146151, 21070816

Unknown
Disease name	Disease term	dbSNP ID	References
Bipolar disorder	Bipolar Disorder, Depression, Bipolar		17525977, 21112154, 16476148, 21714070, 20398908, 15581912, 15581912, 16476148
Brain neoplasms	Brain Neoplasms, Malignant neoplasm of brain, Benign neoplasm of brain, unspecified, Brain Tumor, Primary, Recurrent Brain Neoplasm, Primary malignant neoplasm of brain	rs1800720, rs587781720	27935819
Intracranial neoplasm	Neoplasms, Intracranial		27935819
Cerebral vasospasm	Cerebral Vasospasm		12186470
Disruptive behavior disorder	Disruptive Behavior Disorder		25451971
Down syndrome	Down Syndrome, Down Syndrome, Partial Trisomy 21		12888777
Intracranial vasospasm	Vasospasm, Intracranial		12186470
Manic disorder	Manic, Manic Disorder		16476148, 15581912
Mental depression	Mental Depression, Depressive disorder, Unipolar Depression, Recurrent depression, Major Depressive Disorder	rs587778876, rs587778877	19497163, 8804639, 20962330, 16797859, 8840925, 19497163, 8804639, 8840925, 20962330, 16797859, 19497163, 18939940, 20962330, 20398908, 19497163, 20398908, 20962330, 18939940, 19497163
Mood disorder	Mood Disorders		18939940, 20962330
Oppositional defiant disorder	Oppositional Defiant Disorder		25451971
Trisomy 21	Trisomy 21, Meiotic Nondisjunction, Trisomy 21, Mitotic Nondisjunction		12888777