ERVK-8 (endogenous retrovirus group K member 8, envelope)

Gene

• Entrez ID: 619465
• Gene name: Endogenous retrovirus group K member 8, envelope
• Gene symbol: ERVK-8
• Synonyms: ERVK8, HERV-K115, PR, Protease, Proteinase, envK6
• Chromosome: 8
• Chromosome location: 8p23.1

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003677	Function	DNA binding	IEA
GO:0003964	Function	RNA-directed DNA polymerase activity	IEA
GO:0004523	Function	RNA-DNA hybrid ribonuclease activity	IEA
GO:0006278	Process	RNA-dependent DNA biosynthetic process	IEA
GO:0006310	Process	DNA recombination	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0015074	Process	DNA integration	IEA
GO:0035613	Function	RNA stem-loop binding	IBA	21873635
GO:0090502	Process	RNA phosphodiester bond hydrolysis, endonucleolytic	IEA

Other IDs

• MIM: HGNC

Protein

• UniProt ID: P63122
• Protein name: Endogenous retrovirus group K member 8 Pro protein (HERV-K115 Pro protein) (HERV-K_8p23.1 provirus ancestral Pro protein) (EC 3.4.23.50) (Protease) (Proteinase) (PR)
• Protein function: Retroviral proteases have roles in the processing of the primary translation products and the maturation of the viral particle. Endogenous Pro proteins may have kept, lost or modified their original function during evolution.
• UniProt ID: P63133
• Protein name: Endogenous retrovirus group K member 8 Pol protein (HERV-K115 Pol protein) (HERV-K_8p23.1 provirus ancestral Pol protein) [Includes: Reverse transcriptase (RT) (EC 2.7.7.49); Ribonuclease H (RNase H) (EC 3.1.26.4); Integrase (IN)]
• Protein function: Early post-infection, the reverse transcriptase converts the viral RNA genome into double-stranded viral DNA. The RNase H domain of the reverse transcriptase performs two functions. It degrades the RNA template and specifically removes the RNA p
• UniProt ID: Q902F8
• Protein name: Endogenous retrovirus group K member 8 Env polyprotein (EnvK6 protein) (Envelope polyprotein) (HERV-K115 envelope protein) (HERV-K_8p23.1 provirus ancestral Env polyprotein) [Cleaved into: Surface protein (SU); Transmembrane protein (TM)]
• Protein function: Retroviral envelope proteins mediate receptor recognition and membrane fusion during early infection. Endogenous envelope proteins may have kept, lost or modified their original function during evolution. This endogenous envelope protein has los
• UniProt ID: P62685
• Protein name: Endogenous retrovirus group K member 8 Gag polyprotein (HERV-K115 Gag protein) (HERV-K_8p23.1 provirus ancestral Gag polyprotein) (Gag polyprotein)
• Protein function: The products of the Gag polyproteins of infectious retroviruses perform highly complex orchestrated tasks during the assembly, budding, maturation, and infection stages of the viral replication cycle. During viral assembly, the proteins form mem
• UniProt ID: P61575
• Protein name: Endogenous retrovirus group K member 8 Rec protein (HERV-K115 Rec protein) (HERV-K_8p23.1 provirus Rec protein)
• Protein function: Retroviral replication requires the nuclear export and translation of unspliced, singly-spliced and multiply-spliced derivatives of the initial genomic transcript. Rec interacts with a highly structured RNA element (RcRE) present in the viral 3'
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15695	HERV-K_REC	19 → 105		Family

• Sequence:

  MNPSEMQRKAPPRRRRHRNRAPLTHKMNKMVTSEEQMKLPSTKKAEPPTWAQLKKLTQLA
  TKYLENTKVTQTPESMLLAALMIVSMVSAGVLNSSEETATIENGP

• Sequence length: 105

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	17000049