RNASE3 (ribonuclease A family member 3)

Gene

• Entrez ID: 6037
• Gene name: Ribonuclease A family member 3
• Gene symbol: RNASE3
• Synonyms: ECP, RAF1, RNS3
• Chromosome: 14
• Chromosome location: 14q11.2
• Summary: The protein encoded by this gene belongs to the pancreatic ribonuclease family, a subset of the ribonuclease A superfamily. The protein exhibits antimicrobial activity against pathogenic bacteria [provided by RefSeq, Oct 2014]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2091582	hsa-miR-1909	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001530	Function	Lipopolysaccharide binding	IDA	23992292
GO:0002227	Process	Innate immune response in mucosa	IBA	21873635
GO:0002227	Process	Innate immune response in mucosa	IDA	12860195
GO:0003676	Function	Nucleic acid binding	IEA
GO:0004519	Function	Endonuclease activity	IEA
GO:0004540	Function	Ribonuclease activity	IBA	21873635
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	12860195
GO:0006401	Process	RNA catabolic process	TAS	2745977
GO:0006935	Process	Chemotaxis	IBA	21873635
GO:0019730	Process	Antimicrobial humoral response	TAS
GO:0019731	Process	Antibacterial humoral response	IDA	12860195
GO:0035578	Component	Azurophil granule lumen	TAS
GO:0043152	Process	Induction of bacterial agglutination	IDA	23992292
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0045087	Process	Innate immune response	IDA	23992292
GO:0050829	Process	Defense response to Gram-negative bacterium	IDA	23992292
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	12860195, 23992292
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	12860195
GO:0090501	Process	RNA phosphodiester bond hydrolysis	IEA

Other IDs

• MIM: 131398
• HGNC: 10046
• e!Ensembl: ENSG00000169397

Protein

• UniProt ID: P12724
• Protein name: Eosinophil cationic protein (ECP) (EC 3.1.27.-) (Ribonuclease 3) (RNase 3)
• Protein function: Cytotoxin and helminthotoxin with low-efficiency ribonuclease activity. Possesses a wide variety of biological activities. Exhibits antibacterial activity, including cytoplasmic membrane depolarization of preferentially Gram-negative, but also G
• PDB: 1DYT, 1H1H, 1QMT, 2KB5, 2LVZ, 4A2O, 4A2Y, 4OWZ, 4OXB, 4OXF, 4X08
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00074	RnaseA	33 → 157	Pancreatic ribonuclease	Domain

• Sequence:

  MVPKLFTSQICLLLLLGLMGVEGSLHARPPQFTRAQWFAIQHISLNPPRCTIAMRAINNY
  RWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNI
  SNCTYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI

• Sequence length: 160

Pathways

KEGG:

Asthma

Reactome:

Neutrophil degranulation
Antimicrobial peptides

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Asthma	Asthma	rs324981, rs121912630, rs150116809, rs4950928, rs708494, rs1581842283	12153692, 8874658, 12587966