RGS1 (regulator of G protein signaling 1)

Gene

• Entrez ID: 5996
• Gene name: Regulator of G protein signaling 1
• Gene symbol: RGS1
• Synonyms: 1R20, BL34, HEL-S-87, IER1, IR20
• Chromosome: 1
• Chromosome location: 1q31.2
• Summary: This gene encodes a member of the regulator of G-protein signalling family. This protein is located on the cytosolic side of the plasma membrane and contains a conserved, 120 amino acid motif called the RGS domain. The protein attenuates the signalling ac

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT373740	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT373740	hsa-miR-374a-5p	HITS-CLIP	22473208
MIRT755339	hsa-miR-376b-3p	Luciferase reporter assay	34988161
MIRT1304127	hsa-miR-21	CLIP-seq
MIRT1304128	hsa-miR-3942-5p	CLIP-seq
MIRT1304129	hsa-miR-4703-5p	CLIP-seq
MIRT1304130	hsa-miR-4720-3p	CLIP-seq
MIRT1304131	hsa-miR-590-5p	CLIP-seq
MIRT2314896	hsa-miR-4659a-3p	CLIP-seq
MIRT2314897	hsa-miR-4659b-3p	CLIP-seq
MIRT2314898	hsa-miR-4778-3p	CLIP-seq
MIRT2314896	hsa-miR-4659a-3p	CLIP-seq
MIRT2314897	hsa-miR-4659b-3p	CLIP-seq
MIRT2314898	hsa-miR-4778-3p	CLIP-seq
MIRT2458132	hsa-miR-451b	CLIP-seq
MIRT2458133	hsa-miR-548n	CLIP-seq
MIRT2458134	hsa-miR-548t	CLIP-seq
MIRT2458135	hsa-miR-562	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001965	Function	G-protein alpha-subunit binding	IPI	18434541
GO:0003924	Function	GTPase activity	TAS
GO:0005096	Function	GTPase activator activity	IDA	10480894, 18434541
GO:0005516	Function	Calmodulin binding	TAS	10747990
GO:0005829	Component	Cytosol	IDA	10480894
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	TAS	8241276
GO:0007165	Process	Signal transduction	IDA	10480894
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	10480894
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	TAS	10480894
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	IEA
GO:0009617	Process	Response to bacterium	IEA
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0031234	Component	Extrinsic component of cytoplasmic side of plasma membrane	IDA	10480894
GO:0043547	Process	Positive regulation of GTPase activity	IDA	10480894, 18434541
GO:0061737	Process	Leukotriene signaling pathway	IDA	10480894

Other IDs

• MIM: 600323
• HGNC: 9991
• e!Ensembl: ENSG00000090104

Protein

• UniProt ID: Q08116
• Protein name: Regulator of G-protein signaling 1 (RGS1) (B-cell activation protein BL34) (Early response protein 1R20)
• Protein function: Regulates G protein-coupled receptor signaling cascades, including signaling downstream of the N-formylpeptide chemoattractant receptors and leukotriene receptors (PubMed:10480894). Inhibits B cell chemotaxis toward CXCL12 (By similarity). Inhib
• PDB: 2BV1, 2GTP
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00615	RGS	85 → 199	Regulator of G protein signaling domain	Domain

• Sequence:

  MRAAAISTPKLDKMPGMFFSANPKELKGTTHSLLDDKMQKRRPKTFGMDMKAYLRSMIPH
  LESGMKSSKSKDVLSAAEVMQWSQSLEKLLANQTGQNVFGSFLKSEFSEENIEFWLACED
  YKKTESDLLPCKAEEIYKAFVHSDAAKQINIDFRTRESTAKKIKAPTPTCFDEAQKVIYT
  LMEKDSYPRFLKSDIYLNLLNDLQANSLK

• Sequence length: 209

Pathways

Reactome:

G alpha (q) signalling events
G alpha (i) signalling events

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Dermatitis	Dermatitis, Allergic Contact	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	17374397
Multiple sclerosis	Multiple Sclerosis	rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039, rs483353038, rs61731956, rs568165874, rs767480544	27386562

Unknown
Disease name	Disease term	dbSNP ID	References
Arsenic encephalopathy	Arsenic Encephalopathy		16835338
Dermatologic disorders	Dermatologic disorders		16835338
Mental depression	Depressive disorder	rs587778876, rs587778877	23324853
Osteosarcoma	Osteosarcoma		14767549