RANBP1 (RAN binding protein 1)

Gene

• Entrez ID: 5902
• Gene name: RAN binding protein 1
• Gene symbol: RANBP1
• Synonyms: HTF9A
• Chromosome: 22
• Chromosome location: 22q11.21
• Summary: This gene encodes a protein that forms a complex with Ras-related nuclear protein (Ran) and metabolizes guanoside triphosphate (GTP). This complex participates in the regulation of the cell cycle by controlling transport of proteins and nucleic acids into

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT050368	hsa-miR-24-3p	CLASH	23622248
MIRT573574	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT573572	hsa-miR-3662	PAR-CLIP	20371350
MIRT573573	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT573570	hsa-miR-3646	PAR-CLIP	20371350
MIRT573571	hsa-miR-6507-5p	PAR-CLIP	20371350
MIRT573569	hsa-miR-5584-3p	PAR-CLIP	20371350
MIRT573568	hsa-miR-410-3p	PAR-CLIP	20371350
MIRT573567	hsa-miR-584-3p	PAR-CLIP	20371350
MIRT573566	hsa-miR-4277	PAR-CLIP	20371350
MIRT573565	hsa-miR-4780	PAR-CLIP	20371350
MIRT573564	hsa-miR-6780b-3p	PAR-CLIP	20371350
MIRT573563	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT573562	hsa-miR-623	PAR-CLIP	20371350
MIRT573561	hsa-miR-6083	PAR-CLIP	20371350
MIRT573574	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT573572	hsa-miR-3662	PAR-CLIP	20371350
MIRT573573	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT573570	hsa-miR-3646	PAR-CLIP	20371350
MIRT573571	hsa-miR-6507-5p	PAR-CLIP	20371350
MIRT573569	hsa-miR-5584-3p	PAR-CLIP	20371350
MIRT573568	hsa-miR-410-3p	PAR-CLIP	20371350
MIRT573567	hsa-miR-584-3p	PAR-CLIP	20371350
MIRT573566	hsa-miR-4277	PAR-CLIP	20371350
MIRT573565	hsa-miR-4780	PAR-CLIP	20371350
MIRT573564	hsa-miR-6780b-3p	PAR-CLIP	20371350
MIRT573563	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT573562	hsa-miR-623	PAR-CLIP	20371350
MIRT573561	hsa-miR-6083	PAR-CLIP	20371350
MIRT1289465	hsa-miR-1207-5p	CLIP-seq
MIRT1289466	hsa-miR-186	CLIP-seq
MIRT1289467	hsa-miR-3184	CLIP-seq
MIRT1289468	hsa-miR-410	CLIP-seq
MIRT1289469	hsa-miR-423-5p	CLIP-seq
MIRT1289470	hsa-miR-4688	CLIP-seq
MIRT1289471	hsa-miR-4763-3p	CLIP-seq
MIRT1289472	hsa-miR-486-3p	CLIP-seq
MIRT1289473	hsa-miR-495	CLIP-seq
MIRT1289474	hsa-miR-548ac	CLIP-seq
MIRT1289475	hsa-miR-548ae	CLIP-seq
MIRT1289476	hsa-miR-548aj	CLIP-seq
MIRT1289477	hsa-miR-548am	CLIP-seq
MIRT1289478	hsa-miR-548d-3p	CLIP-seq
MIRT1289479	hsa-miR-548x	CLIP-seq
MIRT1289480	hsa-miR-548z	CLIP-seq
MIRT1289481	hsa-miR-583	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005092	Function	GDP-dissociation inhibitor activity	IMP	7616957
GO:0005096	Function	GTPase activator activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	7616957, 16428860
GO:0005634	Component	Nucleus	TAS	16130169
GO:0005635	Component	Nuclear envelope	TAS
GO:0005643	Component	Nuclear pore	IBA	21873635
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	25743254
GO:0005737	Component	Cytoplasm	TAS	16130169
GO:0005813	Component	Centrosome	IBA	21873635
GO:0005829	Component	Cytosol	IDA
GO:0007165	Process	Signal transduction	TAS	16130169
GO:0016032	Process	Viral process	TAS
GO:0043547	Process	Positive regulation of GTPase activity	IEA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0046604	Process	Positive regulation of mitotic centrosome separation	IBA	21873635
GO:0046907	Process	Intracellular transport	IEA

Other IDs

• MIM: 601180
• HGNC: 9847
• e!Ensembl: ENSG00000099901

Protein

• UniProt ID: P43487
• Protein name: Ran-specific GTPase-activating protein (Ran-binding protein 1) (RanBP1)
• Protein function: Plays a role in RAN-dependent nucleocytoplasmic transport. Alleviates the TNPO1-dependent inhibition of RAN GTPase activity and mediates the dissociation of RAN from proteins involved in transport into the nucleus (By similarity). Induces a conf
• PDB: 1K5D, 1K5G
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00638	Ran_BP1	37 → 161	RanBP1 domain	Domain

• Sequence:

  MAAAKDTHEDHDTSTENTDESNHDPQFEPIVSLPEQEIKTLEEDEEELFKMRAKLFRFAS
  ENDLPEWKERGTGDVKLLKHKEKGAIRLLMRRDKTLKICANHYITPMMELKPNAGSDRAW
  VWNTHADFADECPKPELLAIRFLNAENAQKFKTKFEECRKEIEEREKKAGSGKNDHAEKV
  AEKLEALSVKEETKEDAEEKQ

• Sequence length: 201

Pathways

KEGG:

Human T-cell leukemia virus 1 infection
Viral carcinogenesis

Reactome:

Rev-mediated nuclear export of HIV RNA

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158, rs80357524, rs80357115, rs80357945, rs80357729, rs80357609, rs80357259, rs80357981, rs80358063, rs80357389, rs80356862, rs80359876, rs80357580, rs80358053, rs80358089, rs80187739, rs397507241, rs80358069, rs80357590, rs80357284, rs80357941, rs80359261, rs80359272, rs80359276, rs276174813, rs80358474, rs80359316, rs1555282969, rs80359388, rs80359499, rs80359505, rs80359520, rs80359526, rs80359533, rs56253082, rs80358824, rs80359554, rs80359636, rs80359651, rs80359659, rs80359011, rs80359012, rs80359013, rs80359718, rs397507410, rs81002812, rs80359730, rs80359152, rs80359159, rs397507419, rs28897759, rs80359211, rs80359775, rs397514577, rs397507584, rs80358435, rs80358456, rs80359340, rs80359343, rs80359365, rs80358579, rs397507670, rs80358593, rs80359406, rs80359444, rs80359454, rs276174853, rs276174854, rs80359483, rs80359537, rs80358815, rs80358843, rs80359558, rs80359560, rs80359594, rs80358893, rs28897743, rs397507900, rs397507906, rs397507918, rs80358971, rs80358981, rs397507941, rs80359030, rs80359035, rs41293511, rs397507396, rs81002806, rs80359112, rs397508006, rs81002893, rs45580035, rs80359760, rs397508051, rs80359772, rs4987049, rs80359777, rs80357770, rs397508867, rs62625303, rs397508874, rs80357506, rs80357287, rs273898674, rs80358042, rs80358083, rs80357058, rs41286296, rs80357960, rs80356945, rs80357223, rs386134270, rs80358116, rs80357856, rs80357424, rs397509050, rs80357485, rs80357966, rs397509067, rs80357310, rs80356866, rs80357260, rs80357437, rs80358023, rs80358086, rs80357133, rs80356993, rs80357997, rs80357239, rs80357227, rs397509243, rs80356969, rs80356959, rs63750617, rs63751319, rs587779315, rs200640585, rs398122546, rs80357543, rs398122687, rs80359328, rs398122779, rs398122783, rs62517194, rs80358029, rs515726060, rs180177103, rs180177111, rs180177133, rs587776527, rs180177135, rs180177136, rs515726117, rs587779813, rs587779909, rs587780024, rs587780100, rs28909982, rs121908698, rs180177100, rs587780210, rs587780240, rs587780639, rs587781269, rs587781353, rs587781471, rs587781658, rs587781697, rs587781730, rs587781894, rs587781948, rs587782005, rs587782011, rs200928781, rs587781558, rs370228071, rs587782245, rs587782401, rs180177110, rs587782504, rs72552322, rs587782531, rs587782620, rs587782680, rs587782774, rs587782818, rs730881411, rs730881389, rs564652222, rs397507768, rs587776419, rs730881868, rs730881940, rs56383036, rs758972589, rs201089102, rs730881348, rs786202608, rs786201886, rs786203318, rs786203775, rs786203714, rs786202033, rs750621215, rs786203884, rs786203650, rs772821016, rs863224521, rs864622223, rs864622655, rs375699023, rs876659572, rs768362387, rs876659535, rs876658957, rs483353072, rs876659435, rs267608041, rs876661113, rs730881369, rs878853535, rs772228129, rs878855122, rs760551339, rs80359596, rs397509222, rs886039630, rs886039683, rs886040828, rs587781799, rs886040374, rs886040649, rs397507967, rs878854957, rs886040043, rs1057517589, rs1060502769, rs866380588, rs863224765, rs1064793243, rs747563556, rs1555074976, rs1064795885, rs753961188, rs1064794708, rs869312772, rs1064793887, rs1131690820, rs1135401928, rs1135401868, rs1135401859, rs1553370324, rs397507630, rs1555283160, rs1555283251, rs1555283262, rs1555283361, rs1555286298, rs1555288462, rs886040950, rs1555289566, rs776323117, rs80357123, rs1555579627, rs1555580697, rs80358054, rs1555593302, rs1328985852, rs763470424, rs1555139694, rs878854697, rs1555461217, rs1555461765, rs774684620, rs766416564, rs1554558613, rs1305740166, rs1555461460, rs1555461407, rs1555461586, rs1555567202, rs1555607022, rs1555069815, rs1442299125, rs1474786480, rs1555084947, rs1555457867, rs141087784, rs1482641121, rs1564830522, rs1565469955, rs1565503137, rs864622613, rs755263466, rs757679199, rs1593903166, rs1597801649, rs1603293306, rs879253880, rs80358754, rs1597062038, rs45494092, rs1603275367, rs887358871, rs1597091518, rs1966967065, rs1064793049, rs2082872908, rs2085078278, rs2072475243

Unknown
Disease name	Disease term	dbSNP ID	References
Kidney neoplasm	Kidney Neoplasm		28321044
Kidney cancer	Malignant neoplasm of kidney		28321044