GediPNet logo

RAD52 (RAD52 DNA repair protein)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5893
Gene nameGene Name - the full gene name approved by the HGNC.
RAD52 DNA repair protein
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
RAD52
SynonymsGene synonyms aliases
-
ChromosomeChromosome number
12
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12p13.33
SummarySummary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene shares similarity with Saccharomyces cerevisiae Rad52, a protein important for DNA double-strand break repair and homologous recombination. This gene product was shown to bind single-stranded DNA ends, and mediate the DNA-
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT000156 hsa-miR-210-3p immunoprecipitaion, qRT-PCR 19826008
MIRT000156 hsa-miR-210-3p Luciferase reporter assay, qRT-PCR, Western blot 19141645
MIRT000156 hsa-miR-210-3p Luciferase reporter assay, qRT-PCR, Western blot 19141645
MIRT003914 hsa-miR-373-3p Luciferase reporter assay, qRT-PCR, Western blot 19141645
MIRT717823 hsa-miR-3671 HITS-CLIP 19536157
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000724 Process Double-strand break repair via homologous recombination IBA 21873635
GO:0000730 Process DNA recombinase assembly IEA
GO:0003677 Function DNA binding IDA 19506022
GO:0003697 Function Single-stranded DNA binding IMP 12370410
GO:0005515 Function Protein binding IPI 8702565, 12750383, 14734547, 17765923, 19338310, 24126761, 32296183
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID P43351
Protein name DNA repair protein RAD52 homolog
Protein function Involved in double-stranded break repair. Plays a central role in genetic recombination and DNA repair by promoting the annealing of complementary single-stranded DNA and by stimulation of the RAD51 recombinase. {ECO:0000269|PubMed:12379650, ECO
PDB 1H2I , 1KN0 , 5JRB , 5XRZ , 5XS0 , 8BJM , 8H1P , 8RIL , 8RJ3 , 8RJW , 8TKQ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04098 Rad52_Rad22
35 183
Rad52/22 family double-strand break repair protein
Family
Sequence
MSGTEEAILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGG
QKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSY
HEDVGYGVSEGLKSKALSLEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNKLPR
QLP
LEVDLTKAKRQDLEPSVEEARYNSCRPNMALGHPQLQQVTSPSRPSHAVIPADQDCS
SRSLSSSAVESEATHQRKLRQKQLQQQFRERMEKQQVRVSTPSAEKSEAAPPAPPVTHST
PVTVSEPLLEKDFLAGVTQELIKTLEDNSEKWAVTPDAGDGVVKPSSRADPAQTSDTLAL
NNQMVTQNRTPHSVCHQKPQAKSGSWDLQTYSADQRTTGNWESHRKSQDMKKRKYDPS
Sequence length 418
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  Homologous recombination   SUMOylation of DNA damage response and repair proteins
HDR through Single Strand Annealing (SSA)
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Carcinoma Squamous cell carcinoma rs121912654, rs555607708, rs786202962, rs1564055259 26013599
Lung cancer Malignant neoplasm of lung rs121913530, rs121913529, rs878855122, rs1057519784, rs770315135 26013599, 22899653
Lung carcinoma Carcinoma of lung rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355, rs121912470, rs121913273, rs121913281, rs121913348, rs727503093, rs121913353, rs397516890, rs397516896, rs121913378, rs397516897, rs397516977, rs397516978, rs397516979, rs397516980, rs397516981, rs397516982, rs121913240, rs17851045, rs397517086, rs121913428, rs397517094, rs397517098, rs397517106, rs121913465, rs397517108, rs397517111, rs397517112, rs397517114, rs397517116, rs1554350366, rs397517127, rs397517200, rs397517202, rs121913283, rs121913370, rs121913357, rs727503106, rs121913238, rs727503108, rs397517040, rs397516976, rs1555618025, rs1057519729, rs1584238193 22899653
Unknown
Disease name Disease term dbSNP ID References
Lung neoplasms Lung Neoplasms 26013599

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412