PTX3 (pentraxin 3)

Gene

• Entrez ID: 5806
• Gene name: Pentraxin 3
• Gene symbol: PTX3
• Synonyms: TNFAIP5, TSG-14
• Chromosome: 3
• Chromosome location: 3q25.32
• Summary: This gene encodes a member of the pentraxin protein family. The expression of this protein is induced by inflammatory cytokines in response to inflammatory stimuli in several mesenchymal and epithelial cell types, particularly endothelial cells and mononuclear phagocytes. The protein promotes fibrocyte differentiation and is involved in regulating inflammation and complement activation. It also plays a role in angiogenesis and tissue remodeling. The protein serves as a biomarker for several inflammatory conditions. [provided by RefSeq, Jun 2016]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005954	hsa-miR-21-5p	Luciferase reporter assay	21131358
MIRT054880	hsa-miR-224-5p	Luciferase reporter assay, qRT-PCR, Western blot	24470395
MIRT732871	hsa-miR-9-5p	ELISA, qRT-PCR	28031262

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001550	Process	Ovarian cumulus expansion	IEA
GO:0001849	Function	Complement component C1q complex binding	IBA	21873635
GO:0001849	Function	Complement component C1q complex binding	IDA	23544079
GO:0001872	Function	(1->3)-beta-D-glucan binding	IEA
GO:0001878	Process	Response to yeast	IEA
GO:0005515	Function	Protein binding	IPI	19050261, 19632990, 20363749, 21490156, 22267482, 29374201
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	23544079
GO:0006954	Process	Inflammatory response	TAS	1429570
GO:0008228	Process	Opsonization	IEA
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0031012	Component	Extracellular matrix	IEA
GO:0035580	Component	Specific granule lumen	TAS
GO:0042802	Function	Identical protein binding	IPI	20363749
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0044793	Process	Negative regulation by host of viral process	IBA	21873635
GO:0044869	Process	Negative regulation by host of viral exo-alpha-sialidase activity	IDA	23544079
GO:0044871	Process	Negative regulation by host of viral glycoprotein metabolic process	IDA	23544079
GO:0045087	Process	Innate immune response	IBA	21873635
GO:0045087	Process	Innate immune response	IDA	23544079
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IEA
GO:0046597	Process	Negative regulation of viral entry into host cell	IDA	23544079
GO:0046790	Function	Virion binding	IDA	23544079
GO:0050766	Process	Positive regulation of phagocytosis	IEA
GO:1903016	Process	Negative regulation of exo-alpha-sialidase activity	IDA	23544079
GO:1903019	Process	Negative regulation of glycoprotein metabolic process	IDA	23544079
GO:1904724	Component	Tertiary granule lumen	TAS

Other IDs

• MIM: 602492
• HGNC: 9692
• e!Ensembl: ENSG00000163661

Protein

• UniProt ID: P26022
• Protein name: Pentraxin-related protein PTX3 (Pentaxin-related protein PTX3) (Tumor necrosis factor alpha-induced protein 5) (TNF alpha-induced protein 5) (Tumor necrosis factor-inducible gene 14 protein) (TSG-14)
• Protein function: Plays a role in the regulation of innate resistance to pathogens, inflammatory reactions, possibly clearance of self-components and female fertility.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00354	Pentaxin	181 → 379	Pentaxin family	Domain

• Sequence:

  MHLLAILFCALWSAVLAENSDDYDLMYVNLDNEIDNGLHPTEDPTPCACGQEHSEWDKLF
  IMLENSQMRERMLLQATDDVLRGELQRLREELGRLAESLARPCAPGAPAEARLTSALDEL
  LQATRDAGRRLARMEGAEAQRPEEAGRALAAVLEELRQTRADLHAVQGWAARSWLPAGCE
  TAILFPMRSKKIFGSVHPVRPMRLESFSACIWVKATDVLNKTILFSYGTKRNPYEIQLYL
  SYQSIVFVVGGEENKLVAEAMVSLGRWTHLCGTWNSEEGLTSLWVNGELAATTVEMATGH
  IVPEGGILQIGQEKNGCCVGGGFDETLAFSGRLTGFNIWDSVLSNEEIRETGGAESCHIR
  GNIVGWGVTEIQPHGGAQYVS

• Sequence length: 381

Pathways

Reactome:

Neutrophil degranulation

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Pulmonary fibrosis	Pulmonary Fibrosis	rs121918666, rs199422300, rs121917737, rs121917834, rs199422294, rs201159197, rs199422297, rs199422305, rs751381953, rs876661305, rs878853260, rs863223336, rs786205702, rs1555811762, rs1060502990, rs1555903332, rs1554038539, rs1554042899, rs938938578	22210019

Unknown
Disease name	Disease term	dbSNP ID	References
Mental depression	Unipolar Depression, Major Depressive Disorder	rs587778876, rs587778877	14603263
Alveolitis	Alveolitis, Fibrosing		22210019
Arsenic encephalopathy	Arsenic Encephalopathy		16835338
Dermatologic disorders	Dermatologic disorders		16835338