DPP10 (dipeptidyl peptidase like 10)

Gene

• Entrez ID: 57628
• Gene name: Dipeptidyl peptidase like 10
• Gene symbol: DPP10
• Synonyms: DPL2, DPPY, DPRP-3, DPRP3
• Chromosome: 2
• Chromosome location: 2q14.1
• Summary: This gene encodes a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally prese

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT944148	hsa-miR-4668-3p	CLIP-seq
MIRT944149	hsa-miR-4668-5p	CLIP-seq
MIRT944150	hsa-miR-4705	CLIP-seq
MIRT944151	hsa-miR-105	CLIP-seq
MIRT944152	hsa-miR-192	CLIP-seq
MIRT944153	hsa-miR-215	CLIP-seq
MIRT944154	hsa-miR-3146	CLIP-seq
MIRT944155	hsa-miR-3183	CLIP-seq
MIRT944156	hsa-miR-3671	CLIP-seq
MIRT944157	hsa-miR-3908	CLIP-seq
MIRT944158	hsa-miR-3942-5p	CLIP-seq
MIRT944159	hsa-miR-4272	CLIP-seq
MIRT944160	hsa-miR-4496	CLIP-seq
MIRT944161	hsa-miR-4703-5p	CLIP-seq
MIRT944162	hsa-miR-4723-3p	CLIP-seq
MIRT944163	hsa-miR-4766-3p	CLIP-seq
MIRT944164	hsa-miR-581	CLIP-seq
MIRT944165	hsa-miR-607	CLIP-seq
MIRT944166	hsa-miR-630	CLIP-seq
MIRT1979567	hsa-miR-548p	CLIP-seq
MIRT2448511	hsa-miR-539	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005886	Component	Plasma membrane	ISS
GO:0006508	Process	Proteolysis	IEA
GO:0008076	Component	Voltage-gated potassium channel complex	IBA	21873635
GO:0008076	Component	Voltage-gated potassium channel complex	IPI	27198182
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0008239	Function	Dipeptidyl-peptidase activity	IBA	21873635
GO:0008239	Function	Dipeptidyl-peptidase activity	IDA	12662155
GO:0015459	Function	Potassium channel regulator activity	ISS
GO:0016020	Component	Membrane	IDA	12662155
GO:0044325	Function	Ion channel binding	IPI	27198182
GO:0072659	Process	Protein localization to plasma membrane	ISS
GO:1901379	Process	Regulation of potassium ion transmembrane transport	IBA	21873635
GO:1901379	Process	Regulation of potassium ion transmembrane transport	ISS
GO:1903078	Process	Positive regulation of protein localization to plasma membrane	IDA	15671030

Other IDs

• MIM: 608209
• HGNC: 20823
• e!Ensembl: ENSG00000175497

Protein

• UniProt ID: Q8N608
• Protein name: Inactive dipeptidyl peptidase 10 (Dipeptidyl peptidase IV-related protein 3) (DPRP-3) (Dipeptidyl peptidase X) (DPP X) (Dipeptidyl peptidase-like protein 2) (DPL2)
• Protein function: Promotes cell surface expression of the potassium channel KCND2 (PubMed:15454437). Modulates the activity and gating characteristics of the potassium channel KCND2 (PubMed:15454437). Has no dipeptidyl aminopeptidase activity (PubMed:12662155). {
• PDB: 4WJL
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00930	DPPIV_N	133 → 500	Dipeptidyl peptidase IV (DPP IV) N-terminal region	Family
  PF00326	Peptidase_S9	580 → 784	Prolyl oligopeptidase family	Domain

• Sequence:

  MNQTASVSHHIKCQPSKTIKELGSNSPPQRNWKGIAIALLVILVVCSLITMSVILLTPDE
  LTNSSETRLSLEDLFRKDFVLHDPEARWINDTDVVYKSENGHVIKLNIETNATTLLLENT
  TFVTFKASRHSVSPDLKYVLLAYDVKQIFHYSYTASYVIYNIHTREVWELNPPEVEDSVL
  QYAAWGVQGQQLIYIFENNIYYQPDIKSSSLRLTSSGKEEIIFNGIADWLYEEELLHSHI
  AHWWSPDGERLAFLMINDSLVPTMVIPRFTGALYPKGKQYPYPKAGQVNPTIKLYVVNLY
  GPTHTLELMPPDSFKSREYYITMVKWVSNTKTVVRWLNRAQNISILTVCETTTGACSKKY
  EMTSDTWLSQQNEEPVFSRDGSKFFMTVPVKQGGRGEFHHVAMFLIQSKSEQITVRHLTS
  GNWEVIKILAYDETTQKIYFLSTESSPRGRQLYSASTEGLLNRQCISCNFMKEQCTYFDA
  SFSPMNQHFLLFCEGPRVPVVSLHSTDNPAKYFILESNSMLKEAILKKKIGKPEIKILHI
  DDYELPLQLSLPKDFMDRNQYALLLIMDEEPGGQLVTDKFHIDWDSVLIDMDNVIVARFD
  GRGSGFQGLKILQEIHRRLGSVEVKDQITAVKFLLKLPYIDSKRLSIFGKGYGGYIASMI
  LKSDEKLFKCGSVVAPITDLKLYASAFSERYLGMPSKEESTYQAASVLHNVHGLKEENIL
  IIHGTADTKVHFQHSAELIKHLIKAGVNYTMQVYPDEGHNVSEKSKYHLYSTILKFFSDC
  LKEEISVLPQEPEEDE

• Sequence length: 796

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Autism spectrum disorder	Autism Spectrum Disorders	rs724159978, rs75184679, rs119103221, rs9332964, rs121912562, rs1594344233, rs727504317, rs111033204, rs1801086, rs587784464, rs724159948, rs764659822, rs794727977, rs796052733, rs796052728, rs762292772, rs864321694, rs869312878, rs758432471, rs750896617, rs886039692, rs886039770, rs201037487, rs200483989, rs1057518198, rs1057517708, rs780267761, rs1555910143, rs1057519632, rs775225727, rs751037529, rs1064794848, rs1064795655, rs1131691548, rs1135401811, rs1553248081, rs1454466097, rs1554480537, rs1553578503, rs1553518509, rs774152851, rs1554481395, rs1554464807, rs1554401434, rs1452048149, rs370498156, rs756691187, rs1557863430, rs1557863440, rs1557863546, rs769581210, rs202098093, rs1276388879, rs778792467, rs760059077, rs373783340, rs1557867853, rs772572695, rs753214391, rs749270162, rs548226228, rs1557870645, rs1557874046, rs749548928, rs754532606, rs1557901347, rs1557902023, rs1557909572, rs574335012, rs1557909821, rs1372713010, rs561369202, rs1476293577, rs1557910728, rs1557911386, rs375045125, rs998675361, rs1557916296, rs1557935477, rs866632178, rs1561824498, rs1396313317, rs1564801388, rs1564801473, rs1564950387, rs1565527302, rs1569513495, rs1569305431, rs143944436, rs1563183492, rs1561846159, rs1565819425, rs1562957809, rs1585645641, rs1585016242, rs1595127294, rs1585667374, rs1585653028, rs1585653240, rs1592919048, rs1585645384, rs1789927813	18252227
Leukemia	Leukemia, Myelocytic, Acute	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297, rs11978267, rs4132601	27903959
Narcolepsy	Narcolepsy	rs104894574, rs387906655	19629137

Unknown
Disease name	Disease term	dbSNP ID	References
Liver neoplasms	Liver neoplasms		19233941
Liver cancer	Malignant neoplasm of liver		19233941
Mental depression	Major Depressive Disorder	rs587778876, rs587778877	27622933
Mood disorder	Mood Disorders		27622933
Proliferative diabetic retinopathy	Proliferative diabetic retinopathy		30487263