GediPNet logo

STAMBPL1 (STAM binding protein like 1)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
57559
Gene nameGene Name - the full gene name approved by the HGNC.
STAM binding protein like 1
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
STAMBPL1
SynonymsGene synonyms aliases
ALMalpha, AMSH-FP, AMSH-LP, bA399O19.2
ChromosomeChromosome number
10
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q23.31
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT024279 hsa-miR-215-5p Microarray 19074876
MIRT026552 hsa-miR-192-5p Microarray 19074876
MIRT027048 hsa-miR-103a-3p Sequencing 20371350
MIRT036575 hsa-miR-941 CLASH 23622248
MIRT528487 hsa-miR-5197-5p PAR-CLIP 22012620
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004843 Function Thiol-dependent ubiquitin-specific protease activity IBA 21873635
GO:0005515 Function Protein binding IPI 21163940, 21516116, 25416956, 32296183
GO:0005768 Component Endosome IBA 21873635
GO:0005829 Component Cytosol TAS
GO:0008237 Function Metallopeptidase activity IEA
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q96FJ0
Protein name AMSH-like protease (AMSH-LP) (EC 3.4.19.-) (STAM-binding protein-like 1)
Protein function Zinc metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains (PubMed:18758443, PubMed:35114100). Acts as a positive regulator of the TORC1 signaling pathway by mediating 'Lys-63'-linked deubiquitination of SESN2, thereby i
PDB 2ZNR , 2ZNV , 7L97
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08969 USP8_dimer
22 132
USP8 dimerisation domain
Domain
PF01398 JAB
264 373
JAB1/Mov34/MPN/PAD-1 ubiquitin protease
Family
Sequence
MDQPFTVNSLKKLAAMPDHTDVSLSPEERVRALSKLGCNITISEDITPRRYFRSGVEMER
MASVYLEEGNLENAFVLYNKFITLFVEKLPNHRDYQQCAVPEKQDIMKKLKEIAFPRTDE
LKNDLLKKYNVE
YQEYLQSKNKYKAEILKKLEHQRLIEAERKRIAQMRQQQLESEQFLFF
EDQLKKQELARGQMRSQQTSGLSEQIDGSALSCFSTHQNNSLLNVFADQPNKSDATNYAS
HSPPVNRALTPAATLSAVQNLVVEGLRCVVLPEDLCHKFLQLAESNTVRGIETCGILCGK
LTHNEFTITHVIVPKQSAGPDYCDMENVEELFNVQDQHDLLTLGWIHTHPTQTAFLSSVD
LHTHCSYQLMLPE
AIAIVCSPKHKDTGIFRLTNAGMLEVSACKKKGFHPHTKEPRLFSIC
KHVLVKDIKIIVLDLR
Sequence length 436
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
Reactome
    Metalloprotease DUBs
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Aortic aneurysm Aortic Aneurysm, Familial Thoracic 6 rs1555554098, rs267606902, rs121434526, rs121434527, rs121434528, rs387906592, rs387906781, rs387906782, rs397516685, rs397514037, rs112901682, rs397515325, rs397515330, rs794728025, rs112602953, rs794728021, rs8046180, rs797045725, rs876657852, rs878854466, rs886038978, rs746972765, rs886039303, rs886040965, rs886040966, rs886040967, rs886229659, rs1553781304, rs1060502531, rs1553795301, rs1553803235, rs1213452826, rs869025352, rs1553780501, rs1553785222, rs1382893400, rs1554841990, rs1430822242, rs1567692384, rs1576422965, rs1596712899, rs2059732940, rs2041090817, rs1439991530 21733706, 17994018, 21248741, 25759435, 26153420, 24020716, 27567161, 19409525, 19639654, 24621862, 21937134, 25644172, 24243736, 22831780, 26034244, 27611364, 20734336, 22946110, 22752479, 21212136, 24998021, 21288906, 24293535, 27481187, 25944730
Connective tissue disease Connective Tissue Diseases rs5742905, rs80338688, rs80356506, rs104894800, rs104894948, rs28931614, rs121913482, rs28933068, rs121913483, rs137854464, rs121912870, rs387906980, rs587777352, rs527236145, rs189754995, rs730880214, rs794728188, rs863223852, rs745672741, rs763514968, rs1064793914, rs1085307608, rs1131691804, rs1555399144, rs1554787779, rs1555167139, rs1939205327
Lung cancer Malignant neoplasm of lung rs121913530, rs121913529, rs878855122, rs1057519784, rs770315135 19654303
Lung carcinoma Carcinoma of lung rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355, rs121912470, rs121913273, rs121913281, rs121913348, rs727503093, rs121913353, rs397516890, rs397516896, rs121913378, rs397516897, rs397516977, rs397516978, rs397516979, rs397516980, rs397516981, rs397516982, rs121913240, rs17851045, rs397517086, rs121913428, rs397517094, rs397517098, rs397517106, rs121913465, rs397517108, rs397517111, rs397517112, rs397517114, rs397517116, rs1554350366, rs397517127, rs397517200, rs397517202, rs121913283, rs121913370, rs121913357, rs727503106, rs121913238, rs727503108, rs397517040, rs397516976, rs1555618025, rs1057519729, rs1584238193 19654303

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412