GediPNet logo

GATAD2B (GATA zinc finger domain containing 2B)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
57459
Gene nameGene Name - the full gene name approved by the HGNC.
GATA zinc finger domain containing 2B
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
GATAD2B
SynonymsGene synonyms aliases
GANDS, MRD18, P66beta, p68
ChromosomeChromosome number
1
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q21.3
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes a zinc finger protein transcriptional repressor. The encoded protein is part of the methyl-CpG-binding protein-1 complex, which represses gene expression by deacetylating methylated nucleosomes. Mutations in this gene are linked to intel
SNPsSNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs587776931 G>A Pathogenic Stop gained, coding sequence variant
rs756062872 A>- Likely-pathogenic Frameshift variant, coding sequence variant
rs761820222 G>A,T Pathogenic Stop gained, synonymous variant, coding sequence variant
rs797045594 C>- Pathogenic Coding sequence variant, frameshift variant
rs886037647 CT>- Pathogenic Frameshift variant, coding sequence variant
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016222 hsa-miR-590-3p Sequencing 20371350
MIRT025107 hsa-miR-181a-5p Sequencing 20371350
MIRT028270 hsa-miR-32-5p Sequencing 20371350
MIRT028420 hsa-miR-30a-5p Proteomics 18668040
MIRT051773 hsa-let-7c-5p CLASH 23622248
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA 21873635
GO:0000785 Component Chromatin HDA 16217013
GO:0005515 Function Protein binding IPI 24722188, 25123934, 25150861, 25416956, 26030138, 26816381, 31515488, 32296183
GO:0005654 Component Nucleoplasm IDA
GO:0008270 Function Zinc ion binding IEA
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q8WXI9
Protein name Transcriptional repressor p66-beta (GATA zinc finger domain-containing protein 2B) (p66/p68)
Protein function Transcriptional repressor (PubMed:12183469, PubMed:16415179). Acts as a component of the histone deacetylase NuRD complex which participates in the remodeling of chromatin (PubMed:16428440, PubMed:28977666). Enhances MBD2-mediated repression (Pu
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16563 P66_CC
157 200
Coiled-coil and interaction region of P66A and P66B with MBD2
Coiled-coil
PF00320 GATA
420 454
GATA zinc finger
Domain
Sequence
MDRMTEDALRLNLLKRSLDPADERDDVLAKRLKMEGHEAMERLKMLALLKRKDLANLEVP
HELPTKQDGSGVKGYEEKLNGNLRPHGDNRTAGRPGKENINDEPVDMSARRSEPERGRLT
PSPDIIVLSDNEASSPRSSSRMEERLKAANLEMFKGKGIEERQQLIKQLRDELRLEEARL
VLLKKLRQSQLQKENVVQKT
PVVQNAASIVQPSPAHVGQQGLSKLPSRPGAQGVEPQNLR
TLQGHSVIRSATNTTLPHMLMSQRVIAPNPAQLQGQRGPPKPGLVRTTTPNMNPAINYQP
QSSSSVPCQRTTSSAIYMNLASHIQPGTVNRVSSPLPSPSAMTDAANSQAAAKLALRKQL
EKTLLEIPPPKPPAPLLHFLPSAANSEFIYMVGLEEVVQSVIDSQGKSCASLLRVEPFVC
AQCRTDFTPHWKQEKNGKILCEQCMTSNQKKALK
AEHTNRLKNAFVKALQQEQEIEQRLQ
QQAALSPTTAPAVSSVSKQETIMRHHTLRQAPQPQSSLQRGIPTSARSMLSNFAQAPQLS
VPGGLLGMPGVNIAYLNTGIGGHKGPSLADRQREYLLDMIPPRSISQSISGQK
Sequence length 593
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
KEGG
 
Reactome
  ATP-dependent chromatin remodeling   HDACs deacetylate histones
Regulation of TP53 Activity through Acetylation
RNA Polymerase I Transcription Initiation
Regulation of PTEN gene transcription
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Apraxia Apraxia of Phonation rs121908377, rs121908378, rs1135401820, rs1178491246, rs1584969672 28077840
Autism Autistic behavior rs121964908, rs121912597, rs2710102, rs7794745, rs142990298, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699, rs1553510219, rs1684182454, rs1559060428, rs1553510677, rs1576352885, rs1574152522, rs1574152672, rs1696658542, rs1751123722, rs1750373491, rs1751075634
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291, rs886041382, rs1057518991, rs1057518699, rs753254213, rs748294403, rs762552974, rs1135401795, rs1553121073, rs1553122926, rs1364690005, rs1554086554, rs1554210415, rs1554168326, rs1554776342, rs1553873247, rs1567860112, rs779009256, rs1557447255, rs1564568350, rs780011005, rs1597464953, rs1200336864, rs1569513017, rs1587459606, rs1570332505, rs748888652, rs1575155995, rs2087029320, rs1589669105, rs1601769604, rs1184981709, rs749201074
Tourette syndrome Behavioral tic rs193302861, rs191284403, rs267606861
Unknown
Disease name Disease term dbSNP ID References
Blepharophimosis Blepharophimosis
Bowel incontinence Fecal Incontinence
Congenital epicanthus Congenital Epicanthus
Dyssomnia Dyssomnias

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412