NDRG2 (NDRG family member 2)

Gene

• Entrez ID: 57447
• Gene name: NDRG family member 2
• Gene symbol: NDRG2
• Synonyms: SYLD
• Chromosome: 14
• Chromosome location: 14q11.2
• Summary: This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that may play a role in neurite outgrowth. This gene may be involved in glioblast

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006183	hsa-miR-650	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	21352815
MIRT006183	hsa-miR-650	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	21352815
MIRT006183	hsa-miR-650	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	21352815
MIRT021510	hsa-miR-145-5p	Reporter assay;Microarray	21351259
MIRT736634	hsa-miR-576-3p	qRT-PCR, ELISA	32592365
MIRT736635	hsa-miR-613	qRT-PCR, ELISA	32592365
MIRT1178184	hsa-miR-1200	CLIP-seq
MIRT1178185	hsa-miR-1224-5p	CLIP-seq
MIRT1178186	hsa-miR-4324	CLIP-seq
MIRT1178187	hsa-miR-4751	CLIP-seq
MIRT1178188	hsa-miR-4793-5p	CLIP-seq
MIRT1178189	hsa-miR-544b	CLIP-seq
MIRT2051543	hsa-miR-4761-5p	CLIP-seq
MIRT2579089	hsa-miR-1253	CLIP-seq
MIRT2579090	hsa-miR-181a	CLIP-seq
MIRT2579091	hsa-miR-181b	CLIP-seq
MIRT2579092	hsa-miR-181c	CLIP-seq
MIRT2579093	hsa-miR-181d	CLIP-seq
MIRT2579094	hsa-miR-4262	CLIP-seq
MIRT2579095	hsa-miR-4509	CLIP-seq
MIRT2579096	hsa-miR-4786-3p	CLIP-seq
MIRT2579097	hsa-miR-569	CLIP-seq
MIRT2579098	hsa-miR-642b	CLIP-seq
MIRT2579099	hsa-miR-759	CLIP-seq
MIRT2579100	hsa-miR-9	CLIP-seq
MIRT2686023	hsa-miR-1225-3p	CLIP-seq
MIRT2579089	hsa-miR-1253	CLIP-seq
MIRT2686024	hsa-miR-1257	CLIP-seq
MIRT2686025	hsa-miR-1302	CLIP-seq
MIRT2579090	hsa-miR-181a	CLIP-seq
MIRT2579091	hsa-miR-181b	CLIP-seq
MIRT2579092	hsa-miR-181c	CLIP-seq
MIRT2579093	hsa-miR-181d	CLIP-seq
MIRT2686026	hsa-miR-3127-3p	CLIP-seq
MIRT2579094	hsa-miR-4262	CLIP-seq
MIRT2686027	hsa-miR-4298	CLIP-seq
MIRT2686028	hsa-miR-4323	CLIP-seq
MIRT2579095	hsa-miR-4509	CLIP-seq
MIRT2579096	hsa-miR-4786-3p	CLIP-seq
MIRT2686029	hsa-miR-4790-3p	CLIP-seq
MIRT2686030	hsa-miR-518a-5p	CLIP-seq
MIRT2686031	hsa-miR-527	CLIP-seq
MIRT2579097	hsa-miR-569	CLIP-seq
MIRT2686032	hsa-miR-605	CLIP-seq
MIRT2579098	hsa-miR-642b	CLIP-seq
MIRT2579099	hsa-miR-759	CLIP-seq
MIRT2579100	hsa-miR-9	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
WT1	Activation	17688410

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001818	Process	Negative regulation of cytokine production	IEA
GO:0003674	Function	Molecular_function	ND
GO:0005515	Function	Protein binding	IPI	21217774
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005794	Component	Golgi apparatus	IDA
GO:0005829	Component	Cytosol	NAS	11936845
GO:0007165	Process	Signal transduction	IBA	21873635
GO:0010574	Process	Regulation of vascular endothelial growth factor production	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0021762	Process	Substantia nigra development	HEP	22926577
GO:0030154	Process	Cell differentiation	IEA
GO:0030426	Component	Growth cone	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048662	Process	Negative regulation of smooth muscle cell proliferation	IEA
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IEA
GO:0090361	Process	Regulation of platelet-derived growth factor production	IEA

Other IDs

• MIM: 605272
• HGNC: 14460
• e!Ensembl: ENSG00000165795

Protein

• UniProt ID: Q9UN36
• Protein name: Protein NDRG2 (N-myc downstream-regulated gene 2 protein) (Protein Syld709613)
• Protein function: Contributes to the regulation of the Wnt signaling pathway. Down-regulates CTNNB1-mediated transcriptional activation of target genes, such as CCND1, and may thereby act as tumor suppressor. May be involved in dendritic cell and neuron different
• PDB: 2XMQ, 2XMR, 2XMS
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03096	Ndr	40 → 318	Ndr family	Domain

• Sequence:

  MAELQEVQITEEKPLLPGQTPEAAKEAELAARILLDQGQTHSVETPYGSVTFTVYGTPKP
  KRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPS
  LDQLADMIPCVLQYLNFSTIIGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKGWMD
  WAAHKLTGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLDNIELYWNSYNNR
  RDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQP
  GKLTEAFKYFLQGMGYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSS
  GPPGHTMEVSC

• Sequence length: 371

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Cataract	Cataract, Pseudoaphakia	rs118203965, rs118203966, rs104893685, rs121908938, rs104894175, rs121909048, rs28937573, rs121909049, rs121909050, rs74315488, rs80358200, rs80358203, rs121434643, rs56141211, rs132630322, rs121917775, rs121917735, rs121917736, rs137853199, rs137853200, rs121917867, rs121917869, rs121913555, rs104893736, rs121909595, rs121909596, rs121909597, rs28931605, rs121909598, rs104893618, rs1695062782, rs74315486, rs74315487, rs74315490, rs74315489, rs745938679, rs1566402656, rs74315439, rs74315441, rs121912973, rs121917823, rs1593332981, rs121917825, rs121917827, rs113994108, rs387906963, rs387906964, rs1240503246, rs387906965, rs387906966, rs750207077, rs387907336, rs387907337, rs387907342, rs140332366, rs397514703, rs398122937, rs398122378, rs398122392, rs398122944, rs137853924, rs398122947, rs397515623, rs397515624, rs397515625, rs397515626, rs398122948, rs587778872, rs398123066, rs587777601, rs370424081, rs786205221, rs786205222, rs864309684, rs864309688, rs864309701, rs864309689, rs864309690, rs864309681, rs864309686, rs864309696, rs864309693, rs864309687, rs864309691, rs864309692, rs864309695, rs864309678, rs864309685, rs864309700, rs864309698, rs864309683, rs864309682, rs864309679, rs111534978, rs864309680, rs864309702, rs864622780, rs756898971, rs869312732, rs775038545, rs878852983, rs1114167312, rs1114167313, rs1114167314, rs1114167315, rs1114167307, rs886041410, rs886041412, rs1057518738, rs1057517926, rs1057518878, rs1057519616, rs12799308, rs1064793935, rs1064797219, rs1085307126, rs1085307127, rs765628635, rs1114167427, rs1114167433, rs1554744860, rs1554743428, rs747093432, rs1411557416, rs1555179713, rs1481963503, rs1555549755, rs1456161420, rs1555547008, rs1555889308, rs1555888762, rs766522434, rs1264025914, rs1553585262, rs1567671947, rs1337897299, rs764945940, rs1307969607, rs949335475, rs1184095219, rs776129797, rs1569203234, rs1567668570, rs749141857, rs764098604, rs1184398243, rs1578956689, rs1568480054, rs1564745688, rs1564722302, rs1564723150, rs1571175950, rs1569602837, rs1576552712, rs1575369255, rs981126461, rs1570403798, rs200557771, rs1477743112, rs1651879427, rs1651881222, rs1651919374, rs2024441691, rs148284531, rs1246080692	22043305
Colonic neoplasms	Malignant tumor of colon, Colonic Neoplasms	rs267607789, rs774277300, rs781222233, rs1060502734, rs1060503333, rs1339238483	15059925

Unknown
Disease name	Disease term	dbSNP ID	References
Cerebral ischemia	Brain Stem Ischemia, Transient, Transient Cerebral Ischemia		23451161
Transient ischemic attack	Transient Ischemic Attack, Posterior Circulation Transient Ischemic Attack, Carotid Circulation Transient Ischemic Attack, Transient Ischemic Attack, Vertebrobasilar Circulation, Crescendo Transient Ischemic Attacks, Transient Ischemic Attack, Anterior Circulation		23451161