PTGER4 (prostaglandin E receptor 4)

Gene

• Entrez ID: 5734
• Gene name: Prostaglandin E receptor 4
• Gene symbol: PTGER4
• Synonyms: EP4, EP4R
• Chromosome: 5
• Chromosome location: 5p13.1
• Summary: The protein encoded by this gene is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). This receptor can activate T-cell factor signaling. It has been shown to mediate PGE2 indu

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT053339	hsa-miR-101-3p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot, Motility assay, CAM assay, Colony formation assay	22353936
MIRT053339	hsa-miR-101-3p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot, Motility assay, CAM assay, Colony formation assay	22353936
MIRT439876	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT439875	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT439876	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT726839	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT726840	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT726838	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT726837	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT439875	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT215682	hsa-miR-92a-3p	HITS-CLIP	22473208
MIRT215685	hsa-miR-92b-3p	HITS-CLIP	22473208
MIRT215681	hsa-miR-32-5p	HITS-CLIP	22473208
MIRT1272668	hsa-miR-2054	CLIP-seq
MIRT1272669	hsa-miR-34c-3p	CLIP-seq
MIRT1272670	hsa-miR-380	CLIP-seq
MIRT1272671	hsa-miR-4428	CLIP-seq
MIRT1272672	hsa-miR-4775	CLIP-seq
MIRT1272673	hsa-miR-590-3p	CLIP-seq
MIRT1272674	hsa-miR-889	CLIP-seq
MIRT2306449	hsa-miR-1237	CLIP-seq
MIRT2306450	hsa-miR-1263	CLIP-seq
MIRT2306451	hsa-miR-3120-3p	CLIP-seq
MIRT2306452	hsa-miR-3177-5p	CLIP-seq
MIRT2306453	hsa-miR-3192	CLIP-seq
MIRT2306454	hsa-miR-3614-5p	CLIP-seq
MIRT2306455	hsa-miR-3663-3p	CLIP-seq
MIRT2306456	hsa-miR-4303	CLIP-seq
MIRT2306457	hsa-miR-4501	CLIP-seq
MIRT2306458	hsa-miR-4504	CLIP-seq
MIRT2306459	hsa-miR-542-3p	CLIP-seq
MIRT2457400	hsa-miR-188-5p	CLIP-seq
MIRT2457401	hsa-miR-204	CLIP-seq
MIRT2457402	hsa-miR-211	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFKB1	Unknown	23300802
RELA	Unknown	23300802
XBP1	Unknown	23300802

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001818	Process	Negative regulation of cytokine production	ISS
GO:0001819	Process	Positive regulation of cytokine production	ISS
GO:0004957	Function	Prostaglandin E receptor activity	IBA	21873635
GO:0004957	Function	Prostaglandin E receptor activity	IDA	8163486
GO:0005515	Function	Protein binding	IPI	16424369
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0006954	Process	Inflammatory response	IBA	21873635
GO:0006955	Process	Immune response	IEP	8862514
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IDA	8163486
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA	21873635
GO:0007254	Process	JNK cascade	ISS
GO:0009612	Process	Response to mechanical stimulus	IEP	21723865
GO:0016021	Component	Integral component of membrane	NAS	8163486
GO:0030278	Process	Regulation of ossification	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0033624	Process	Negative regulation of integrin activation	IDA	21681739
GO:0042093	Process	T-helper cell differentiation	ISS
GO:0050728	Process	Negative regulation of inflammatory response	IBA	21873635
GO:0050728	Process	Negative regulation of inflammatory response	IDA	16424369
GO:0050729	Process	Positive regulation of inflammatory response	ISS
GO:0051492	Process	Regulation of stress fiber assembly	ISS
GO:0060348	Process	Bone development	ISS
GO:0070371	Process	ERK1 and ERK2 cascade	ISS
GO:0071260	Process	Cellular response to mechanical stimulus	ISS
GO:0071380	Process	Cellular response to prostaglandin E stimulus	IBA	21873635
GO:2000420	Process	Negative regulation of eosinophil extravasation	IDA	21681739

Other IDs

• MIM: 601586
• HGNC: 9596
• e!Ensembl: ENSG00000171522

Protein

• UniProt ID: P35408
• Protein name: Prostaglandin E2 receptor EP4 subtype (PGE receptor EP4 subtype) (PGE2 receptor EP4 subtype) (Prostanoid EP4 receptor)
• Protein function: Receptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(s) proteins that stimulate adenylate cyclase. Has a relaxing effect on smooth muscle. May play an important role in regulating renal hemodynamics, intestinal ep
• PDB: 5YHL, 5YWY, 7D7M, 8GCM, 8GCP, 8GD9, 8GDA, 8GDB
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	34 → 329	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MSTPGVNSSASLSPDRLNSPVTIPAVMFIFGVVGNLVAIVVLCKSRKEQKETTFYTLVCG
  LAVTDLLGTLLVSPVTIATYMKGQWPGGQPLCEYSTFILLFFSLSGLSIICAMSVERYLA
  INHAYFYSHYVDKRLAGLTLFAVYASNVLFCALPNMGLGSSRLQYPDTWCFIDWTTNVTA
  HAAYSYMYAGFSSFLILATVLCNVLVCGALLRMHRQFMRRTSLGTEQHHAAAAASVASRG
  HPAASPALPRLSDFRRRRSFRRIAGAEIQMVILLIATSLVVLICSIPLVVRVFVNQLYQP
  SLEREVSKNPDLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIKCLFCRIGGSRRERSG
  QHCSDSQRTSSAMSGHSRSFISRELKEISSTSQTLLPDLSLPDLSENGLGGRNLLPGVPG
  MGLAQEDTTSLRTLRISETSDSSQGQDSESVLLVDEAGGSGRAGPAPKGSSLQVTFPSET
  LNLSEKCI

• Sequence length: 488

Pathways

KEGG:

Neuroactive ligand-receptor interaction
Efferocytosis
Inflammatory mediator regulation of TRP channels
Renin secretion
Human cytomegalovirus infection
Human papillomavirus infection
Pathways in cancer

Reactome:

Prostanoid ligand receptors
G alpha (s) signalling events
ADORA2B mediated anti-inflammatory cytokines production

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Lymphoma	Lymphoma	rs11540652, rs1592119138, rs1592123162, rs1599367044	19075289

Unknown
Disease name	Disease term	dbSNP ID	References
Ankylosing spondylitis	Ankylosing spondylitis		21743469
Corpus luteum cyst	Corpus Luteum Cyst		21239663
Endometrioma	Endometrioma		19407222
Endometriosis	Endometriosis	rs1800629, rs1143634	19407222
Ovarian cysts	Ovarian Cysts		21239663