PTGER2 (prostaglandin E receptor 2)

Gene

• Entrez ID: 5732
• Gene name: Prostaglandin E receptor 2
• Gene symbol: PTGER2
• Synonyms: COX-2, EP2
• Chromosome: 14
• Chromosome location: 14q22.1
• Summary: This gene encodes a receptor for prostaglandin E2, a metabolite of arachidonic acid which has different biologic activities in a wide range of tissues. Mutations in this gene are associated with aspirin-induced susceptibility to asthma. [provided by RefSe

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019383	hsa-miR-148b-3p	Microarray	17612493
MIRT438345	hsa-miR-149-5p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	25916550
MIRT438345	hsa-miR-149-5p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	25916550
MIRT438345	hsa-miR-149-5p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	25916550
MIRT438345	hsa-miR-149-5p	ELISA, Luciferase reporter assay, qRT-PCR, Western blot	25916550
MIRT1272599	hsa-miR-1276	CLIP-seq
MIRT1272600	hsa-miR-128	CLIP-seq
MIRT1272601	hsa-miR-130a	CLIP-seq
MIRT1272602	hsa-miR-130b	CLIP-seq
MIRT1272603	hsa-miR-148a	CLIP-seq
MIRT1272604	hsa-miR-148b	CLIP-seq
MIRT1272605	hsa-miR-152	CLIP-seq
MIRT1272606	hsa-miR-188-3p	CLIP-seq
MIRT1272607	hsa-miR-19a	CLIP-seq
MIRT1272608	hsa-miR-19b	CLIP-seq
MIRT1272609	hsa-miR-27a	CLIP-seq
MIRT1272610	hsa-miR-27b	CLIP-seq
MIRT1272611	hsa-miR-301a	CLIP-seq
MIRT1272612	hsa-miR-301b	CLIP-seq
MIRT1272613	hsa-miR-3666	CLIP-seq
MIRT1272614	hsa-miR-421	CLIP-seq
MIRT1272615	hsa-miR-4272	CLIP-seq
MIRT1272616	hsa-miR-4295	CLIP-seq
MIRT1272617	hsa-miR-4311	CLIP-seq
MIRT1272618	hsa-miR-454	CLIP-seq
MIRT1272619	hsa-miR-4709-5p	CLIP-seq
MIRT1272620	hsa-miR-4731-3p	CLIP-seq
MIRT1272621	hsa-miR-4801	CLIP-seq
MIRT1272622	hsa-miR-496	CLIP-seq
MIRT1272623	hsa-miR-499-3p	CLIP-seq
MIRT1272624	hsa-miR-499a-3p	CLIP-seq
MIRT1272625	hsa-miR-532-3p	CLIP-seq
MIRT1272626	hsa-miR-580	CLIP-seq
MIRT1272627	hsa-miR-583	CLIP-seq
MIRT1272628	hsa-miR-616	CLIP-seq
MIRT2080156	hsa-miR-4328	CLIP-seq
MIRT2080157	hsa-miR-4420	CLIP-seq
MIRT2080158	hsa-miR-4503	CLIP-seq
MIRT2306422	hsa-miR-2115	CLIP-seq
MIRT2306423	hsa-miR-214	CLIP-seq
MIRT2306424	hsa-miR-3619-5p	CLIP-seq
MIRT2306425	hsa-miR-3692	CLIP-seq
MIRT2306426	hsa-miR-3977	CLIP-seq
MIRT1272614	hsa-miR-421	CLIP-seq
MIRT1272615	hsa-miR-4272	CLIP-seq
MIRT2306427	hsa-miR-4690-5p	CLIP-seq
MIRT1272619	hsa-miR-4709-5p	CLIP-seq
MIRT2306428	hsa-miR-516a-3p	CLIP-seq
MIRT1272628	hsa-miR-616	CLIP-seq
MIRT2306429	hsa-miR-761	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
SETBP1	Repression	18419541

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004957	Function	Prostaglandin E receptor activity	IBA	21873635
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	10462542
GO:0006954	Process	Inflammatory response	IBA	21873635
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	ISS
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA	21873635
GO:0071380	Process	Cellular response to prostaglandin E stimulus	IBA	21873635
GO:0071380	Process	Cellular response to prostaglandin E stimulus	ISS
GO:1904346	Process	Positive regulation of gastric mucosal blood circulation	IEA

Other IDs

• MIM: 176804
• HGNC: 9594
• e!Ensembl: ENSG00000125384

Protein

• UniProt ID: P43116
• Protein name: Prostaglandin E2 receptor EP2 subtype (PGE receptor EP2 subtype) (PGE2 receptor EP2 subtype) (Prostanoid EP2 receptor)
• Protein function: Receptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(s) proteins that stimulate adenylate cyclase. The subsequent raise in intracellular cAMP is responsible for the relaxing effect of this receptor on smooth muscl
• PDB: 7CX2, 7CX3, 7CX4
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	56 → 315	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGR
  RSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFS
  LATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQ
  YCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGS
  GRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQA
  LRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL

• Sequence length: 358

Pathways

KEGG:

cAMP signaling pathway
Neuroactive ligand-receptor interaction
Efferocytosis
Inflammatory mediator regulation of TRP channels
Renin secretion
Human cytomegalovirus infection
Pathways in cancer

Reactome:

Prostanoid ligand receptors
G alpha (s) signalling events
ADORA2B mediated anti-inflammatory cytokines production

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Asthma	Asthma, Asthma, Aspirin-Induced	rs324981, rs121912630, rs150116809, rs4950928, rs708494, rs1581842283	16502481

Unknown
Disease name	Disease term	dbSNP ID	References
Endometrioma	Endometrioma		19407222
Endometriosis	Endometriosis	rs1800629, rs1143634	19407222
Nasal polyposis	Nasal Polyps
Subfertility	Subfertility		10359563