TTC7A (tetratricopeptide repeat domain 7A)
|
Gene
|
Entrez ID
Entrez Gene ID - the GENE ID in NCBI Gene database.
|
57217 |
Gene nameGene Name - the full gene name approved by the HGNC.
|
Tetratricopeptide repeat domain 7A |
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
|
TTC7A |
SynonymsGene synonyms aliases
|
GIDID, MINAT, TTC7 |
ChromosomeChromosome number
|
2 |
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
|
2p21 |
SummarySummary of gene provided in NCBI Entrez Gene.
|
This gene encodes a protein containing tetratricopeptide repeats. Mutations in this gene disrupt intestinal development and can cause early onset inflammatory bowel disease and intestinal atresia. Alternative splicing results in multiple transcript varian |
SNPsSNP information provided by dbSNP.
|
SNP ID |
Visualize variation |
Clinical significance |
Consequence |
rs139010200 |
A>C,G |
Pathogenic, conflicting-interpretations-of-pathogenicity |
Non coding transcript variant, coding sequence variant, intron variant, missense variant |
rs149602485 |
T>A,C |
Pathogenic, conflicting-interpretations-of-pathogenicity |
Non coding transcript variant, missense variant, coding sequence variant, genic downstream transcript variant, downstream transcript variant |
rs150269540 |
C>T |
Pathogenic |
5 prime UTR variant, non coding transcript variant, missense variant, coding sequence variant, genic upstream transcript variant |
rs201100272 |
T>C |
Conflicting-interpretations-of-pathogenicity |
Coding sequence variant, non coding transcript variant, intron variant, missense variant |
rs202044972 |
G>A,T |
Pathogenic |
Coding sequence variant, genic downstream transcript variant, missense variant |
rs587776971 |
AAGT>- |
Pathogenic |
Splice donor variant, intron variant, genic upstream transcript variant, non coding transcript variant, coding sequence variant |
rs587776972 |
T>C |
Pathogenic, likely-pathogenic |
Missense variant, genic downstream transcript variant, coding sequence variant |
rs587777547 |
C>T |
Pathogenic |
Genic upstream transcript variant, 5 prime UTR variant, stop gained, non coding transcript variant, coding sequence variant |
rs587777548 |
C>G,T |
Pathogenic, likely-benign |
Synonymous variant, genic upstream transcript variant, 5 prime UTR variant, stop gained, non coding transcript variant, coding sequence variant |
rs587777549 |
G>- |
Pathogenic |
Intron variant, non coding transcript variant, coding sequence variant, frameshift variant |
rs587777550 |
->G |
Pathogenic |
Non coding transcript variant, coding sequence variant, frameshift variant |
rs587777551 |
T>A |
Pathogenic |
Intron variant |
rs755985958 |
C>T |
Likely-pathogenic |
Genic downstream transcript variant, coding sequence variant, missense variant |
rs766411601 |
A>C,T |
Pathogenic, uncertain-significance |
Missense variant, non coding transcript variant, coding sequence variant, genic upstream transcript variant, 5 prime UTR variant, stop gained |
rs768053395 |
->C |
Likely-pathogenic |
Genic downstream transcript variant, frameshift variant, coding sequence variant |
rs773754673 |
C>G,T |
Likely-pathogenic |
Non coding transcript variant, missense variant, stop gained, coding sequence variant, 5 prime UTR variant, genic upstream transcript variant |
rs776906926 |
C>T |
Pathogenic |
Missense variant, non coding transcript variant, coding sequence variant, intron variant |
rs777469885 |
G>T |
Pathogenic |
Splice acceptor variant, intron variant, genic upstream transcript variant |
rs786205698 |
C>T |
Pathogenic |
Coding sequence variant, non coding transcript variant, stop gained, intron variant |
rs876657392 |
A>G |
Pathogenic |
Splice acceptor variant |
rs876657393 |
G>A |
Pathogenic |
Coding sequence variant, missense variant, genic downstream transcript variant |
rs886037746 |
G>- |
Pathogenic |
5 prime UTR variant, coding sequence variant, genic upstream transcript variant, splice donor variant, non coding transcript variant |
rs886037747 |
TCTA>- |
Pathogenic |
Stop gained, coding sequence variant, genic upstream transcript variant, 5 prime UTR variant, non coding transcript variant |
rs886042805 |
G>T |
Pathogenic |
Stop gained, coding sequence variant, genic upstream transcript variant, 5 prime UTR variant, non coding transcript variant |
rs886042806 |
->C |
Pathogenic |
Coding sequence variant, frameshift variant, non coding transcript variant |
rs989682938 |
G>A |
Likely-pathogenic |
Genic upstream transcript variant, stop gained, intron variant, non coding transcript variant, coding sequence variant |
rs1057516047 |
C>T |
Pathogenic |
Coding sequence variant, stop gained, genic downstream transcript variant |
rs1297794582 |
C>T |
Pathogenic |
Coding sequence variant, non coding transcript variant, stop gained |
rs1558568116 |
G>A |
Pathogenic, likely-pathogenic |
Non coding transcript variant, stop gained, coding sequence variant |
rs1572849873 |
->C |
Pathogenic |
Coding sequence variant, frameshift variant, 5 prime UTR variant, non coding transcript variant, genic upstream transcript variant |
rs1572961263 |
G>C |
Pathogenic |
Intron variant |
rs1573068097 |
T>C |
Likely-pathogenic |
Coding sequence variant, genic downstream transcript variant, missense variant |
|
miRNAmiRNA information provided by mirtarbase database.
|
|
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
|
|
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
|
|
Protein
|
UniProt ID |
Q9ULT0 |
Protein name |
Tetratricopeptide repeat protein 7A (TPR repeat protein 7A) |
Protein function |
Component of a complex required to localize phosphatidylinositol 4-kinase (PI4K) to the plasma membrane (PubMed:23229899, PubMed:24417819). The complex acts as a regulator of phosphatidylinositol 4-phosphate (PtdIns(4)P) synthesis (Probable). In |
Family and domains |
Pfam
Accession |
ID |
Position in sequence |
Description |
Type |
PF13181 |
TPR_8 |
745 → 777 |
Tetratricopeptide repeat |
Repeat |
PF13181 |
TPR_8 |
813 → 846 |
Tetratricopeptide repeat |
Repeat |
|
Sequence |
MAAKGAHGSYLKVESELERCRAEGHWDRMPELVRQLQTLSMPGGGGNRRGSPSAAFTFPD TDDFGKLLLAEALLEQCLKENHAKIKDSMPLLEKNEPKMSEAKNYLSSILNHGRLSPQYM CEAMLILGKLHYVEGSYRDAISMYARAGIDDMSMENKPLYQMRLLSEAFVIKGLSLERLP NSIASRFRLTEREEEVITCFERASWIAQVFLQELEKTTNNSTSRHLKGCHPLDYELTYFL EAALQSAYVKNLKKGNIVKGMRELREVLRTVETKATQNFKVMAAKHLAGVLLHSLSEECY WSPLSHPLPEFMGKEESSFATQALRKPHLYEGDNLYCPKDNIEEALLLLLISESMATRDV VLSRVPEQEEDRTVSLQNAAAIYDLLSITLGRRGQYVMLSECLERAMKFAFGEFHLWYQV ALSMVACGKSAYAVSLLRECVKLRPSDPTVPLMAAKVCIGSLRWLEEAEHFAMMVISLGE EAGEFLPKGYLALGLTYSLQATDATLKSKQDELHRKALQTLERAQQLAPSDPQVILYVSL QLALVRQISSAMEQLQEALKVRKDDAHALHLLALLFSAQKHHQHALDVVNMAITEHPENF NLMFTKVKLEQVLKGPEEALVTCRQVLRLWQTLYSFSQLGGLEKDGSFGEGLTMKKQSGM HLTLPDAHDADSGSRRASSIAASRLEEAMSELTMPSSVLKQGPMQLWTTLEQIWLQAAEL FMEQQHLKEAGFCIQEAAGLFPTSHSVLYMRGRLAEVKGNLEEAKQLYKEALTVNPDGVR IMHSLGLMLSRLGHKSLAQKVLRDAVERQSTCHEAWQGLGEVLQAQGQNEAAVDCFLTAL ELEASSPVLPFSIIPREL
|
|
Sequence length |
858 |
Interactions |
View interactions |
Associated diseases
|
Causal |
Disease name |
Disease term |
dbSNP ID |
References |
Diabetes mellitus |
Diabetes Mellitus, Insulin-Dependent |
rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs4402960, rs1362648752, rs3745368, rs3792267, rs3842570, rs5030952, rs2975760, rs119489103, rs7903146, rs12255372, rs11196205, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237, rs80356613, rs137852740, rs137852786, rs387906407, rs151344623, rs28938469, rs28936371, rs137852672, rs80356637, rs80356642, rs80356653, rs137852673, rs137852674, rs80356634, rs80356651, rs193929360, rs137853334, rs137853335, rs137853336, rs1600731198, rs137853338, rs121964882, rs121964883, rs387906511, rs121964884, rs121964885, rs2147483647, rs387906512, rs121964887, rs121964888, rs121964889, rs121964890, rs121964891, rs28934878, rs74315383, rs121964893, rs886037620, rs886037621, rs80356663, rs121434593, rs121913150, rs587776825, rs137853236, rs2135842335, rs137853237, rs137853238, rs2135818776, rs1566092470, rs1463923467, rs137853243, rs137853244, rs2135839114, rs137853245, rs2135847417, rs121918407, rs104894005, rs104894006, rs80356655, rs104894008, rs104894009, rs104894010, rs104894011, rs80356654, rs104894016, rs193929376, rs193929374, rs193929375, rs193929373, rs80356666, rs80356669, rs80356664, rs193929366, rs1048095, rs193929355, rs193929356, rs1259467443, rs104893642, rs387906777, rs387906779, rs141804752, rs182349376, rs184917682, rs193922396, rs193922400, rs193922401, rs137852676, rs193922407, rs193922638, rs193922257, rs193922258, rs193922259, rs193922260, rs193922261, rs193922262, rs193922263, rs193922264, rs193922265, rs193922268, rs193921338, rs193922269, rs193922272, rs193922273, rs193922275, rs193922278, rs193922279, rs193922280, rs193922281, rs193922282, rs193922283, rs193922284, rs193922286, rs193922287, rs193922289, rs193922291, rs193922295, rs193922297, rs193922300, rs193922302, rs193922303, rs193922308, rs193922313, rs193922314, rs144723656, rs193922315, rs193922316, rs193922317, rs148311934, rs193922319, rs193922320, rs193922326, rs193922329, rs193922330, rs193922331, rs193922335, rs193922336, rs193922338, rs193922340, rs193922341, rs193922471, rs193922475, rs193922476, rs193922479, rs193922355, rs193922356, rs193922576, rs193922578, rs193922582, rs193922588, rs193922592, rs193922594, rs193922596, rs386134267, rs193922598, rs193922599, rs193922600, rs193922604, rs193922605, rs397514580, rs397515519, rs267601516, rs587780343, rs587780345, rs587780346, rs587780347, rs587780357, rs148954387, rs61736969, rs587783673, rs587783672, rs587783669, rs786204676, rs794727236, rs151344624, rs794727775, rs794727839, rs199946797, rs869320673, rs796065047, rs759072800, rs797045595, rs797045209, rs797045207, rs797045213, rs797045623, rs863225280, rs149703259, rs864321656, rs139964066, rs777870079, rs878853246, rs769268803, rs886039380, rs886041392, rs886041391, rs886042610, rs143064649, rs1057516192, rs746480424, rs1057516281, rs576684889, rs754728827, rs1057520291, rs1057520779, rs893256143, rs1057520504, rs1057524790, rs1057524902, rs1057524904, rs1057524905, rs764232985, rs1064793998, rs1064794268, rs769086289, rs369429452, rs1085307913, rs1131691416, rs765432081, rs1131692182, rs748749585, rs1554335441, rs762263694, rs1312678560, rs767565869, rs1375656631, rs1554335391, rs1360415315, rs1554335616, rs1554335752, rs1554909277, rs769518471, rs757171524, rs768951263, rs762703502, rs1555212248, rs1555212359, rs1555813319, rs1555816654, rs1553638903, rs1553638909, rs948820149, rs371977235, rs1553784995, rs76474829, rs200998587, rs1415041911, rs1554334894, rs1260178539, rs1554335421, rs1555211904, rs779184183, rs1554335564, rs200670692, rs1400535021, rs1554334872, rs1555212749, rs1553876668, rs1553878211, rs954727530, rs1554924035, rs372307320, rs925231098, rs1554913069, rs1554933565, rs766431403, rs746714109, rs751279984, rs770664202, rs1008906426, rs758844607, rs1554924540, rs1566092307, rs753998395, rs1565885935, rs1167124132, rs1376796469, rs556436603, rs1562715657, rs1486280029, rs1564869850, rs755259997, rs769569410, rs1172328722, rs1286294151, rs1375557127, rs1568731279, rs1562715426, rs556581174, rs1564865302, rs1565886545, rs776793516, rs1568724014, rs1392795567, rs781260712, rs1562719705, rs1382448285, rs1564977373, rs750586210, rs1598842892, rs1583592247, rs780612692, rs1593060859, rs1476637197, rs751279776, rs1593060890, rs1191912908, rs1167675604, rs1583601110, rs1593058932, rs778611627, rs753296261 |
|
Multiple gastrointestinal atresias |
Multiple gastrointestinal atresias (disorder), Combined immunodeficiency-enteropathy spectrum |
rs587776972, rs886037747, rs777469885, rs876657392, rs786205698, rs147914967, rs1057516047, rs1558568116, rs766411601, rs1572849873, rs1297794582, rs773754673, rs1684975294, rs1673619175 |
25534311, 24417819, 23423984, 24292712, 25174867, 25745186, 24931897, 23830146, 26938784, 25546680, 27302973 |
Prostate cancer |
Prostate carcinoma |
rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582 |
20932654 |
Severe combined immunodeficiency disease |
Severe Combined Immunodeficiency, Combined immunodeficiency |
rs886037607, rs118203993, rs121908714, rs121908739, rs121908740, rs121908735, rs121908721, rs121908722, rs121908156, rs1564414523, rs1564418254, rs1564446526, rs786205074, rs121908157, rs121908159, rs786200884, rs397515357, rs104894562, rs137852624, rs137852625, rs137852626, rs137852627, rs137852507, rs137852509, rs111033619, rs111033620, rs1569480018, rs111033621, rs137852510, rs587776729, rs111033622, rs111033617, rs111033618, rs121917894, rs121917896, rs2133313409, rs121917897, rs28933392, rs104894282, rs104894283, rs104894285, rs121918570, rs121918572, rs730880318, rs104893674, rs730880319, rs104894453, rs104894454, rs104894451, rs137853206, rs777503956, rs267606645, rs267606648, rs397515390, rs193922346, rs193922347, rs193922348, rs193922349, rs193922350, rs137852508, rs193922640, rs193922641, rs193922643, rs193922645, rs193922361, rs193922364, rs193922464, rs148508754, rs193922574, rs113994174, rs606231246, rs397514671, rs397514686, rs397514755, rs199474679, rs199474685, rs199474686, rs199474681, rs150739647, rs267605358, rs886041036, rs587777335, rs587778405, rs145092287, rs587777562, rs606231256, rs200296680, rs786205456, rs786205517, rs774202259, rs786205615, rs878853261, rs786205890, rs782753385, rs746052951, rs869025224, rs869312857, rs869320660, rs869320659, rs869320658, rs879253742, rs886037924, rs886037925, rs750610248, rs886039394, rs761242509, rs886039387, rs886041043, rs886041044, rs886042051, rs886041333, rs749481781, rs1057517747, rs1057519506, rs1057523762, rs1057521062, rs1057520644, rs761583890, rs751635016, rs55729925, rs1064793248, rs1064793347, rs1064794027, rs781410769, rs1555524788, rs1486760100, rs769633203, rs1556330713, rs1555322558, rs1556330234, rs1556330755, rs1556329779, rs1556330552, rs1556329822, rs1556330286, rs1556331272, rs2146178281, rs376610445, rs757797994, rs775704953, rs1555743321, rs1564995660, rs1564995662, rs1556330249, rs144104577, rs886041796, rs1026474882, rs570768621, rs1556330562, rs1556330568, rs780014431, rs778343059, rs1555844617, rs1567629968, rs1567628757, rs1567629943, rs1567632864, rs1567632829, rs1567626023, rs1559328006, rs1561423197, rs1452483770, rs1568400897, rs1569479913, rs1568404443, rs1569480047, rs1563340753, rs368303189, rs1568431262, rs1568431102, rs1561424886, rs1602289943, rs1241698978, rs1569479994, rs1569480082, rs1602289649, rs1573261820, rs770985198, rs1589050343, rs1340132582, rs1589064324, rs1589070600, rs1213680890, rs149316157, rs1599873591, rs755706305, rs1602288051, rs1602289411, rs1602289183, rs1583513256, rs1589136659, rs1380154594, rs1011307501, rs1599876167, rs1569967422, rs1602289631, rs1573262398, rs760191638, rs1592117677, rs1640406042, rs372597855, rs1839558393, rs1839622622, rs1839957089, rs777008519, rs1233957241, rs2092261618, rs1839255008, rs1677695565, rs936493226, rs1162344514, rs991089005 |
24417819 |
Ventricular septal defect |
Ventricular Septal Defects |
rs104894073, rs387906775 |
26938784 |
|
Unknown |
Disease name |
Disease term |
dbSNP ID |
References |
Absent eyebrow |
Absent eyebrow |
|
|
Autoimmune hemolytic anemia |
Autoimmune hemolytic anemia |
|
|
Congenital atresia of colon |
Congenital atresia of colon |
|
26938784 |
Congenital atresia of ileum |
Congenital atresia of ileum |
|
26938784 |
Congenital atresia of pulmonary valve |
Congenital atresia of pulmonary valve |
|
26938784 |
Congenital cystic adenomatoid malformation of lung |
Cystic Adenomatoid Malformation of Lung, Congenital |
|
|
Congenital hypoplasia of thymus |
Congenital hypoplasia of thymus |
|
|
Congenital malrotation of intestine |
Congenital malrotation of intestine |
|
|
Congenital omphalocele |
Congenital omphalocele |
|
|
Congenital pyloric atresia |
Congenital pyloric atresia |
|
26938784 |
Erectile dysfunction |
Erectile dysfunction |
|
20932654 |
Gastrointestinal atresia |
Gastrointestinal atresia |
|
|
Hashimoto disease |
Hashimoto Disease |
|
|
Intestinal atresia |
Intestinal Atresia |
|
26938784 |
Jejunal atresia |
Jejunal Atresia |
|
26938784 |
Nail dystrophy |
Dystrophia unguium |
|
|
Psoriasiform eczema |
Psoriasiform eczema |
|
|
|
|
|