GediPNet logo

GOPC (golgi associated PDZ and coiled-coil motif containing)

Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
57120
Gene nameGene Name - the full gene name approved by the HGNC.
Golgi associated PDZ and coiled-coil motif containing
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
GOPC
SynonymsGene synonyms aliases
CAL, FIG, GOPC1, PIST, dJ94G16.2
ChromosomeChromosome number
6
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q22.1
SummarySummary of gene provided in NCBI Entrez Gene.
This gene encodes a Golgi protein with a PDZ domain. The PDZ domain is globular and proteins which contain them bind other proteins through short motifs near the C-termini. Mice which are deficient in the orthologous protein have globozoospermia and are i
miRNAmiRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT020115 hsa-miR-130b-3p Sequencing 20371350
MIRT027025 hsa-miR-103a-3p Sequencing 20371350
MIRT1027357 hsa-miR-140-3p CLIP-seq
MIRT1027358 hsa-miR-219-2-3p CLIP-seq
MIRT1027359 hsa-miR-23a CLIP-seq
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IEA
GO:0005515 Function Protein binding IPI 11384996, 11707463, 12471024, 19027007, 20195357, 25416956, 25609649, 26179146, 29892012, 31515488
GO:0005737 Component Cytoplasm IDA 11707463
GO:0005765 Component Lysosomal membrane TAS
GO:0005794 Component Golgi apparatus IBA 21873635
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM
HGNC
e!Ensembl
Protein
UniProt ID Q9HD26
Protein name Golgi-associated PDZ and coiled-coil motif-containing protein (CFTR-associated ligand) (Fused in glioblastoma) (PDZ protein interacting specifically with TC10) (PIST)
Protein function Plays a role in intracellular protein trafficking and degradation (PubMed:11707463, PubMed:14570915, PubMed:15358775). May regulate CFTR chloride currents and acid-induced ASIC3 currents by modulating cell surface expression of both channels (By
PDB 2DC2 , 2LOB , 4E34 , 4E35 , 4JOE , 4JOF , 4JOG , 4JOH , 4JOJ , 4JOK , 4JOP , 4JOR , 4K6Y , 4K72 , 4K75 , 4K76 , 4K78 , 4NMO , 4NMP , 4NMQ , 4NMR , 4NMS , 4NMT , 4NMV , 4Q6H , 4Q6S , 5IC3 , 5K4F , 6OV7 , 6V84 , 6XNJ , 7JZO , 7JZP , 7JZQ , 7JZR
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00595 PDZ
288 368
PDZ domain
Domain
Sequence
MSAGGPCPAAAGGGPGGASCSVGAPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQA
DITYEGRQKMTSLSSCFAQLCHKAQSVSQINHKLEAQLVDLKSELTETQAEKVVLEKEVH
DQLLQLHSIQLQLHAKTGQSADSGTIKAKLSGPSVEELERELEANKKEKMKEAQLEAEVK
LLRKENEALRRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLGRDMKGPAHDKLWNQL
EAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLG
ISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQR
GEIEFEVV
YVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQG
FNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLYHKKSY
Sequence length 462
Interactions View interactions
PathwaysPathway information has different metabolic/signaling pathways associated with genes. Each record is hyperlinked to a complete information page which also includes links to the KEGG/Reactome pathway database.
 
Reactome
    RHO GTPases regulate CFTR trafficking
Associated diseases
Causal
Disease name Disease term dbSNP ID References
Atrial fibrillation Atrial Fibrillation rs120074192, rs121908590, rs121908593, rs121434558, rs587776851, rs387906612, rs387906613, rs387906614, rs387906615, rs199472687, rs199472705, rs199473324, rs587777336, rs587777339, rs587777557, rs587777558, rs587777559, rs587777560, rs886037778, rs769405762, rs770372675 29892015
Male infertility Male infertility due to globozoospermia rs554675432, rs9332971, rs397507505, rs797045116, rs748618094, rs781431741, rs1555979575, rs377581367
Melanoma melanoma rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs1563902635, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340, rs398123152, rs587780668, rs587782083, rs587782206, rs587782792, rs180177042, rs121913381, rs730881675, rs730881674, rs730881677, rs730881673, rs1800586, rs768966657, rs587778189, rs786204195, rs121913321, rs45476696, rs864622636, rs864622263, rs869025340, rs876660436, rs876658534, rs876658556, rs878853647, rs878853644, rs878853650, rs886041162, rs121913389, rs1057519852, rs121913384, rs121913387, rs1060501266, rs1060501263, rs1060501262, rs749714198, rs1060501265, rs559848002, rs1064794292, rs1131691187, rs1131691186, rs199907548, rs1554654052, rs1554656411, rs1554656624, rs1554653915, rs1554653956, rs1554656253, rs1554654224, rs754806883, rs1057520039, rs1563889584, rs1563889685, rs1287464120, rs1563888944, rs1563892715, rs1563889847, rs141798398, rs1587332338, rs1587340291, rs11552823, rs561034503, rs138677674, rs1819962958, rs1820531050 22535842
Unknown
Disease name Disease term dbSNP ID References
Paroxysmal atrial fibrillation Paroxysmal atrial fibrillation rs199865688, rs397515994, rs757096307 29892015

| © 2021, Biomedical Informatics Centre, NIRRH |
ICMR-National Institute for Research in Reproductive Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Tel: +91-22-24192104, Fax No: +91-22-24139412