SLC17A7 (solute carrier family 17 member 7)

Gene

• Entrez ID: 57030
• Gene name: Solute carrier family 17 member 7
• Gene symbol: SLC17A7
• Synonyms: BNPI, VGLUT1
• Chromosome: 19
• Chromosome location: 19q13.33
• Summary: The protein encoded by this gene is a vesicle-bound, sodium-dependent phosphate transporter that is specifically expressed in the neuron-rich regions of the brain. It is preferentially associated with the membranes of synaptic vesicles and functions in gl

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017615	hsa-miR-335-5p	Microarray	18185580
MIRT1353545	hsa-miR-106a	CLIP-seq
MIRT1353546	hsa-miR-106b	CLIP-seq
MIRT1353547	hsa-miR-1245	CLIP-seq
MIRT1353548	hsa-miR-1273f	CLIP-seq
MIRT1353549	hsa-miR-17	CLIP-seq
MIRT1353550	hsa-miR-20a	CLIP-seq
MIRT1353551	hsa-miR-20b	CLIP-seq
MIRT1353552	hsa-miR-3160-3p	CLIP-seq
MIRT1353553	hsa-miR-3177-3p	CLIP-seq
MIRT1353554	hsa-miR-4300	CLIP-seq
MIRT1353555	hsa-miR-4428	CLIP-seq
MIRT1353556	hsa-miR-4765	CLIP-seq
MIRT1353557	hsa-miR-488	CLIP-seq
MIRT1353558	hsa-miR-519a	CLIP-seq
MIRT1353559	hsa-miR-519b-3p	CLIP-seq
MIRT1353560	hsa-miR-519c-3p	CLIP-seq
MIRT1353561	hsa-miR-519d	CLIP-seq
MIRT1353562	hsa-miR-548t	CLIP-seq
MIRT1353563	hsa-miR-920	CLIP-seq
MIRT1353564	hsa-miR-93	CLIP-seq
MIRT2104626	hsa-miR-1286	CLIP-seq
MIRT2104627	hsa-miR-1827	CLIP-seq
MIRT2104628	hsa-miR-4436a	CLIP-seq
MIRT2104629	hsa-miR-940	CLIP-seq
MIRT2329079	hsa-miR-1184	CLIP-seq
MIRT2329080	hsa-miR-1205	CLIP-seq
MIRT2329081	hsa-miR-1301	CLIP-seq
MIRT2329082	hsa-miR-223	CLIP-seq
MIRT2329083	hsa-miR-3158-5p	CLIP-seq
MIRT2329084	hsa-miR-4660	CLIP-seq
MIRT2329085	hsa-miR-4697-3p	CLIP-seq
MIRT2329086	hsa-miR-4704-3p	CLIP-seq
MIRT2329087	hsa-miR-5047	CLIP-seq
MIRT2329088	hsa-miR-622	CLIP-seq
MIRT2459506	hsa-miR-1270	CLIP-seq
MIRT2459507	hsa-miR-4254	CLIP-seq
MIRT2459508	hsa-miR-4292	CLIP-seq
MIRT2459509	hsa-miR-4308	CLIP-seq
MIRT2459510	hsa-miR-4683	CLIP-seq
MIRT2459511	hsa-miR-4781-5p	CLIP-seq
MIRT2459512	hsa-miR-577	CLIP-seq
MIRT2459513	hsa-miR-620	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003407	Process	Neural retina development	IEA
GO:0005313	Function	L-glutamate transmembrane transporter activity	IBA	21873635
GO:0005313	Function	L-glutamate transmembrane transporter activity	TAS
GO:0005326	Function	Neurotransmitter transmembrane transporter activity	IBA	21873635
GO:0005436	Function	Sodium:phosphate symporter activity	TAS	8632143
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Ion transport	TAS
GO:0006817	Process	Phosphate ion transport	IEA
GO:0006820	Process	Anion transport	IBA	21873635
GO:0007420	Process	Brain development	IEA
GO:0014047	Process	Glutamate secretion	TAS
GO:0015319	Function	Sodium:inorganic phosphate symporter activity	IDA	10820226
GO:0015813	Process	L-glutamate transmembrane transport	IEA
GO:0016021	Component	Integral component of membrane	IBA	21873635
GO:0016021	Component	Integral component of membrane	IDA	10820226
GO:0022857	Function	Transmembrane transporter activity	IBA	21873635
GO:0030285	Component	Integral component of synaptic vesicle membrane	IBA	21873635
GO:0030672	Component	Synaptic vesicle membrane	TAS
GO:0035249	Process	Synaptic transmission, glutamatergic	IBA	21873635
GO:0035725	Process	Sodium ion transmembrane transport	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0043229	Component	Intracellular organelle	IEA
GO:0048786	Component	Presynaptic active zone	IEA
GO:0050803	Process	Regulation of synapse structure or activity	IBA	21873635
GO:0060076	Component	Excitatory synapse	IBA	21873635
GO:0060203	Component	Clathrin-sculpted glutamate transport vesicle membrane	TAS
GO:0098700	Process	Neurotransmitter loading into synaptic vesicle	IBA	21873635
GO:1900242	Process	Regulation of synaptic vesicle endocytosis	IEA

Other IDs

• MIM: 605208
• HGNC: 16704
• e!Ensembl: ENSG00000104888

Protein

• UniProt ID: Q9P2U7
• Protein name: Vesicular glutamate transporter 1 (VGluT1) (Brain-specific Na(+)-dependent inorganic phosphate cotransporter) (Solute carrier family 17 member 7)
• Protein function: Multifunctional transporter that transports L-glutamate as well as multiple ions such as chloride, proton, potassium, sodium and phosphate (PubMed:10820226). At the synaptic vesicle membrane, mainly functions as an uniporter which transports pre
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07690	MFS_1	68 → 453	Major Facilitator Superfamily	Family

• Sequence:

  MEFRQEEFRKLAGRALGKLHRLLEKRQEGAETLELSADGRPVTTQTRDPPVVDCTCFGLP
  RRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGGHVVVQKAQFSWDPETVGLIH
  GSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYGCVIFVRILQG
  LVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYV
  YGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPLTKFSTPWRRFFT
  SMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQ
  IADFLRSRRIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAIS
  GFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHY
  GGVIFYGVFASGEKQPWAEPEEMSEEKCGFVGHDQLAGSDDSEMEDEAEPPGAPPAPPPS
  YGATHSTFQPPRPPPPVRDY

• Sequence length: 560

Pathways

KEGG:

Synaptic vesicle cycle
Retrograde endocannabinoid signaling
Glutamatergic synapse
Nicotine addiction

Reactome:

Glutamate Neurotransmitter Release Cycle
Organic anion transporters

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Schizophrenia	Schizophrenia	rs74315508, rs74315509, rs13447324, rs1558507406, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	22197296, 21145444, 23356950, 21396926
Seizure	Complex partial seizures, Generalized seizures, Visual seizure, Tonic - clonic seizures, Single Seizure	rs587784365, rs28939683, rs74315390, rs28939684, rs74315391, rs267607198, rs74315392, rs118192244, rs118192250, rs121917749, rs121917750, rs121917751, rs121917752, rs267606670, rs267607061, rs121912707, rs118192249, rs118192251, rs118192217, rs118192218, rs118192219, rs118192222, rs118192226, rs118192228, rs118192234, rs118192236, rs118192235, rs118192241, rs118192242, rs118192185, rs118192188, rs118192245, rs118192246, rs118192186, rs118192194, rs118192197, rs118192199, rs118192201, rs118192202, rs118192203, rs118192204, rs118192205, rs118192206, rs118192208, rs118192211, rs118192216, rs118192239, rs387906684, rs387906686, rs387906687, rs1596893185, rs387907126, rs387907281, rs397515405, rs587778771, rs730882067, rs730882073, rs397514579, rs397514582, rs587776976, rs398122394, rs121918784, rs121918751, rs121918735, rs398123588, rs587780450, rs61749751, rs587777620, rs727503974, rs730882124, rs794726710, rs794726697, rs794726799, rs794727444, rs794727740, rs796053166, rs794726825, rs796052676, rs796053219, rs796053220, rs796053228, rs796052653, rs759584387, rs796052650, rs796052641, rs796052626, rs796052623, rs796052663, rs796052615, rs796052802, rs797044999, rs797045047, rs797045942, rs797045941, rs118192212, rs797044938, rs777257591, rs864321712, rs879255652, rs886039268, rs886039517, rs886039529, rs199497486, rs886039496, rs886039903, rs886041300, rs769827124, rs886041339, rs886041591, rs587783092, rs1555850151, rs1057516123, rs1057516121, rs1057516115, rs1057516111, rs1057516106, rs1057516105, rs756921902, rs1057516089, rs1057516087, rs1057516080, rs1057516076, rs1060499544, rs1555850512, rs1057517919, rs118192231, rs1057520413, rs1060503101, rs1064796294, rs1064794981, rs1064794632, rs1064797245, rs1131691830, rs1131692231, rs1131691936, rs1554626549, rs1553579225, rs1553531385, rs121918736, rs1554898088, rs1553579282, rs763353895, rs1553463119, rs1554093891, rs77838305, rs1555408401, rs1554627439, rs1554097873, rs1555850403, rs1064794719, rs1315483224, rs1567134495, rs770187706, rs1057518555, rs1576983339, rs1574192005, rs1459374430, rs1586800133, rs1574641522, rs1572096837, rs1572630269, rs1574554892, rs1574556643, rs1574571769, rs1574641605, rs1574697769, rs1574716524, rs1574746733, rs1574746935, rs1574752700, rs1574754680, rs863225030, rs1601545088, rs1600714727, rs1371059392, rs1600767259, rs1339542565, rs1600785769, rs2065899210, rs1600732174, rs1162306056, rs879255709, rs1900111672, rs2066910297, rs1554122080, rs796052941, rs1600789325, rs2082695884, rs1737677036, rs1737495759, rs868389022, rs1737685202, rs1737672350, rs762737130	18495095

Unknown
Disease name	Disease term	dbSNP ID	References
Anhedonia	Anhedonia		19409534, 22707231
Bipolar disorder	Bipolar Disorder		19839996, 20079890
Clonic seizures	Clonic Seizures		18495095
Hypotonic seizures	Epileptic drop attack		18495095
Jacksonian seizure	Jacksonian Seizure		18495095
Learning disorders	Learning Disorders, Adult Learning Disorders, Learning Disturbance, Learning Disabilities		21295146
Memory disorders	Memory Disorders		21295146
Age-related memory disorders	Age-Related Memory Disorders		21295146