PYY (peptide YY)

Gene

• Entrez ID: 5697
• Gene name: Peptide YY
• Gene symbol: PYY
• Synonyms: PYY-I, PYY1
• Chromosome: 17
• Chromosome location: 17q21.31
• Summary: This gene encodes a member of the neuropeptide Y (NPY) family of peptides. The encoded preproprotein is proteolytically processed to generate two alternative peptide products that differ in length by three amino acids. These peptides, secreted by endocrin

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1552826	hsa-miR-4314	CLIP-seq
MIRT1552827	hsa-miR-4667-5p	CLIP-seq
MIRT1552828	hsa-miR-4700-5p	CLIP-seq
MIRT1552829	hsa-miR-615-5p	CLIP-seq
MIRT1552830	hsa-miR-637	CLIP-seq
MIRT1552826	hsa-miR-4314	CLIP-seq
MIRT1552827	hsa-miR-4667-5p	CLIP-seq
MIRT1552828	hsa-miR-4700-5p	CLIP-seq
MIRT1552829	hsa-miR-615-5p	CLIP-seq
MIRT1552830	hsa-miR-637	CLIP-seq
MIRT2308047	hsa-miR-1827	CLIP-seq
MIRT2308048	hsa-miR-3612	CLIP-seq
MIRT1552826	hsa-miR-4314	CLIP-seq
MIRT1552827	hsa-miR-4667-5p	CLIP-seq
MIRT1552828	hsa-miR-4700-5p	CLIP-seq
MIRT1552829	hsa-miR-615-5p	CLIP-seq
MIRT1552830	hsa-miR-637	CLIP-seq
MIRT2308049	hsa-miR-650	CLIP-seq
MIRT1552826	hsa-miR-4314	CLIP-seq
MIRT1552827	hsa-miR-4667-5p	CLIP-seq
MIRT1552828	hsa-miR-4700-5p	CLIP-seq
MIRT1552829	hsa-miR-615-5p	CLIP-seq
MIRT1552830	hsa-miR-637	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001664	Function	G protein-coupled receptor binding	IBA	21873635
GO:0001664	Function	G protein-coupled receptor binding	IPI	7493937, 7592911
GO:0005179	Function	Hormone activity	IBA	21873635
GO:0005184	Function	Neuropeptide hormone activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	23597562
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007218	Process	Neuropeptide signaling pathway	IBA	21873635
GO:0007631	Process	Feeding behavior	IBA	21873635
GO:0031841	Function	Neuropeptide Y receptor binding	IBA	21873635
GO:0060575	Process	Intestinal epithelial cell differentiation	TAS	10488139

Other IDs

• MIM: 600781
• HGNC: 9748
• e!Ensembl: ENSG00000131096

Protein

• UniProt ID: P10082
• Protein name: Peptide YY (PYY) (PYY-I) (Peptide tyrosine tyrosine) [Cleaved into: Peptide YY(3-36) (PYY-II)]
• Protein function: This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility.
• PDB: 2DEZ, 2DF0, 2L60, 2NA5, 7RT9, 7YON
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00159	Hormone_3	30 → 64	Pancreatic hormone peptide	Family

• Sequence:

  MVFVRRPWPALTTVLLALLVCLGALVDAYPIKPEAPREDASPEELNRYYASLRHYLNLVT
  RQRYGKRDGPDTLLSKTFFPDGEDRPVRSRSEGPDLW

• Sequence length: 97

Pathways

KEGG:

Neuroactive ligand-receptor interaction

Reactome:

Peptide ligand-binding receptors
G alpha (i) signalling events

Associated diseases

Causal
Disease name	Disease term	dbSNP ID	References
Alzheimer disease	Familial Alzheimer Disease (FAD), Alzheimer Disease, Late Onset, Alzheimer Disease, Early Onset, Alzheimer`s Disease, Alzheimer`s Disease, Focal Onset	rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039, rs63750973, rs63749810, rs63750643, rs193922916, rs63750306, rs63750590, rs63750526, rs63751235, rs661, rs63751037, rs63749885, rs63750231, rs63751229, rs63751272, rs63751223, rs63750391, rs63751163, rs281875357, rs63751141, rs63750082, rs121917807, rs63751399, rs63750265, rs63751144, rs63750886, rs63751068, rs121917808, rs63749891, rs63750083, rs63749824, rs63750577, rs267606983, rs63750218, rs63751287, rs63750900, rs145518263, rs63751475, rs63750450, rs63749805, rs63751278, rs63751106, rs63750004, rs63749806, rs63751024, rs63750248, rs63750779, rs63751139, rs63750219, rs63750298, rs63750687, rs63750851, rs1553268799, rs1561901881, rs1561905293, rs866101707, rs1566638673, rs63750009, rs1566656702, rs1566657804, rs1567885728, rs1568339995, rs1566630791, rs1555358260, rs63750964, rs1594998354, rs63751316	11709213
Anencephaly	Iniencephaly, Exencephaly	rs773607884	17400914
Neural tube defect	Neural Tube Defects	rs121918220, rs121434297, rs137853061, rs137853062, rs3127334, rs267607167, rs267607168, rs387907204, rs139365610, rs137955120, rs786201015, rs786201016, rs768434408, rs777661576, rs747846362, rs200137991, rs780014899, rs574132670, rs786204013, rs147257424, rs763539350, rs776483190, rs757259023, rs781461462, rs762921297, rs1114167354, rs557643577, rs147277149, rs765586205, rs377443637, rs1563593163, rs1303000329, rs1565818580, rs986604359, rs1293600145, rs114727354, rs146357218, rs768980918, rs140277700, rs139645527, rs750323424, rs368321176, rs1579619636, rs893229476, rs754990692, rs763079713, rs1593037878, rs747100389, rs372056091, rs1593083585, rs778121031, rs748778907, rs776969786, rs1189298981, rs375908206, rs1734858651, rs778738842	17400914
Obesity	Obesity	rs34911341, rs74315349, rs1474810899, rs2282440, rs2491132, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562, rs121913564, rs74315393, rs121913556, rs2989924, rs193922650, rs193922685, rs193922687, rs751160202, rs1421085, rs747681609, rs1553400259, rs13447339, rs370479598, rs1554394014, rs1553174844, rs756232889, rs369841551, rs1557670950, rs1571321748, rs148538980, rs1572820988, rs1591461970, rs1419374563, rs745921568, rs144159890, rs1570714352, rs779783209, rs1573250294, rs1573254045, rs1580744791, rs1580746829, rs6548238, rs7138803, rs7754840	16368708

Unknown
Disease name	Disease term	dbSNP ID	References
Acrania	Acrania		17400914
Anorexia	Anorexia		29689362, 22903826
Craniorachischisis	Craniorachischisis		17400914
Diastematomyelia	Diastematomyelia		17400914
Mental depression	Mental Depression, Depressive disorder	rs587778876, rs587778877	8625912, 21410462
Neurenteric cyst	Neurenteric Cyst		17400914
Primary tethered cord syndrome	Tethered Cord Syndrome		17400914
Senile dementia	Presenile dementia, Acute Confusional Senile Dementia		11709213
Spinal cord myelodysplasia	Spinal Cord Myelodysplasia		17400914