Gene
|
Entrez ID
Entrez Gene ID - the GENE ID in NCBI Gene database.
|
56911 |
Gene nameGene Name - the full gene name approved by the HGNC.
|
MAP3K7 C-terminal like |
Gene symbolGene Symbol - the official gene symbol approved by the HGNC, which is a short abbreviated form of the gene name.
|
MAP3K7CL |
SynonymsGene synonyms aliases
|
C21orf7, HC21ORF7, TAK1L, TAKL, TAKL-1, TAKL-2, TAKL-4 |
ChromosomeChromosome number
|
21 |
Chromosome locationChromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
|
21q21.3 |
miRNAmiRNA information provided by mirtarbase database.
|
|
Gene ontology (GO)Gene ontology information of associated ontologies with gene provided by GO database.
|
|
Other IDsOther ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
|
|
Protein
|
UniProt ID |
P57077 |
Protein name |
MAP3K7 C-terminal-like protein (TAK1-like protein) |
Family and domains |
|
Sequence |
MISTARVPADKPVRIAFSLNDASDDTPPEDSIPLVFPELDQQLQPLPPCHDSEESMEVFK QHCQIAEEYHEVKKEITLLEQRKKELIAKLDQAEKEKVDAAELVREFEALTEENRTLRLA QSQCVEQLEKLRIQYQKRQGSS
|
|
Sequence length |
142 |
Interactions |
View interactions |
Associated diseases
|
|