TCIM (transcriptional and immune response regulator)

Gene

• Entrez ID: 56892
• Gene name: Transcriptional and immune response regulator
• Gene symbol: TCIM
• Synonyms: C8orf4, TC-1, TC1
• Chromosome: 8
• Chromosome location: 8p11.21
• Summary: This gene encodes a small, monomeric, predominantly unstructured protein that functions as a positive regulator of the Wnt/beta-catenin signaling pathway. This protein interacts with a repressor of beta-catenin mediated transcription at nuclear speckles.

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002264	Process	Endothelial cell activation involved in immune response	IBA	21873635
GO:0002264	Process	Endothelial cell activation involved in immune response	IDA	19684084
GO:0005112	Function	Notch binding	IBA	21873635
GO:0005112	Function	Notch binding	IPI	25985737
GO:0005515	Function	Protein binding	IPI	16424001
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	16424001, 17603013
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA	16424001
GO:0005737	Component	Cytoplasm	IDA	16424001, 17603013
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0006915	Process	Apoptotic process	IEA
GO:0010739	Process	Positive regulation of protein kinase A signaling	IDA	15087392
GO:0016607	Component	Nuclear speck	IDA	16424001
GO:0034605	Process	Cellular response to heat	IDA	17603013
GO:0043066	Process	Negative regulation of apoptotic process	IDA	15087392
GO:0043620	Process	Regulation of DNA-templated transcription in response to stress	IDA	17603013
GO:0045746	Process	Negative regulation of Notch signaling pathway	IBA	21873635
GO:0045746	Process	Negative regulation of Notch signaling pathway	IDA	25985737
GO:1900020	Process	Positive regulation of protein kinase C activity	IDA	15087392
GO:1901224	Process	Positive regulation of NIK/NF-kappaB signaling	IDA	19684084
GO:1902806	Process	Regulation of cell cycle G1/S phase transition	IDA	18959821
GO:1903706	Process	Regulation of hemopoiesis	IEA

Other IDs

• MIM: 607702
• HGNC: 1357
• e!Ensembl: ENSG00000176907

Protein

• UniProt ID: Q9NR00
• Protein name: Transcriptional and immune response regulator (Thyroid cancer protein 1) (TC-1)
• Protein function: Seems to be involved in the regulation of cell growth an differentiation, may play different and opposite roles depending on the tissue or cell type. May enhance the WNT-CTNNB1 pathway by relieving antagonistic activity of CBY1 (PubMed:16424001,
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15063	TC1	10 → 85	Thyroid cancer protein 1	Family

• Sequence:

  MKAKRSHQAVIMSTSLRVSPSIHGYHFDTASRKKAVGNIFENTDQESLERLFRNSGDKKA
  EERAKIIFAIDQDVEEKTRALMALKKRTKDKLFQFLKLRKYSIKVH

• Sequence length: 106

Associated diseases

Unknown
Disease name	Disease term	dbSNP ID	References
Liver carcinoma	Liver carcinoma		28284560